Property Summary

Ligand Count 5
NCBI Gene PubMed Count 120
PubMed Score 63.06
PubTator Score 48.60

Knowledge Summary

Patent (5,186)

Expression

  Differential Expression (11)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.212 2.6e-04
group 3 medulloblastoma 1.300 7.7e-04
malignant mesothelioma -2.100 8.6e-08
oligodendroglioma 1.400 1.5e-02
osteosarcoma 1.223 5.5e-03
ovarian cancer 1.900 1.0e-07
pancreatic cancer -1.200 7.8e-03
pancreatic ductal adenocarcinoma liver m... 1.054 1.3e-02
psoriasis 1.700 8.4e-04
spina bifida -1.426 3.0e-02
Waldenstrons macroglobulinemia 1.343 6.4e-04

Gene RIF (71)

AA Sequence

MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW      1 - 70
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK     71 - 140
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS    141 - 210
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ    211 - 280
GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS    281 - 350
TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK        351 - 416
//

Text Mined References (132)

PMID Year Title