Property Summary

Ligand Count 21
NCBI Gene PubMed Count 86
PubMed Score 98.28
PubTator Score 41.41

Knowledge Summary

Patent (2,250)

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.300 5.9e-04
astrocytoma 1.500 2.7e-03
atypical teratoid / rhabdoid tumor 1.500 5.4e-08
breast carcinoma 1.300 6.0e-03
cutaneous lupus erythematosus 1.200 5.3e-03
ependymoma 1.600 3.7e-03
glioblastoma 1.200 4.9e-07
invasive ductal carcinoma 1.100 8.4e-05
lung cancer 1.200 5.3e-04
malignant mesothelioma -1.600 3.1e-07
Multiple myeloma 1.146 5.8e-03
oligodendroglioma 1.600 9.9e-04
osteosarcoma -1.719 6.7e-04
ovarian cancer -1.900 1.4e-08
psoriasis 1.100 2.4e-04
tuberculosis -1.100 4.8e-05

PDB (17)

Gene RIF (38)

AA Sequence

MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRW      1 - 70
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK     71 - 140
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS    141 - 210
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ    211 - 280
GFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTS    281 - 350
HTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR         351 - 415
//

Text Mined References (109)

PMID Year Title