Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1579.47
PubTator Score 32.02

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (9)

AA Sequence

MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVE      1 - 70
PIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH     71 - 140
LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQI    141 - 210
YPVTQPLAPVHNPISV                                                          211 - 226
//

Text Mined References (26)

PMID Year Title