Property Summary

NCBI Gene PubMed Count 23
PubMed Score 1518.36
PubTator Score 32.02

Knowledge Summary

Patent

No data available

Synonym

Accession P05814 Q4VAZ9 Q9UCM5
Symbols CASB

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25087955 Exogenous 5-HT decreased beta-casein expression in MCF-12A human mammary epithelial cells and was responsible for inhibiting phosphorylation of STAT5, resulting in a decline in lactational function.
24364857 The acidic fragment of human Abeta (Abeta1-11) and a phosphorylated fragment of beta-Casein induced tau fibrillization in vitro.
24189037 Milk congestion gives rise to higher levels of beta-casomorphin-8 in milk and plasma than in lactating women without problems.
19463972 derivatives of peptide fragment (54-59) exhibit immunosuppressant activity
19460752 Knockdown of casein beta (CSN2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16973758 a negative cross talk between PR and Stat5a/GR may contribute to the physiological role of progesterone to repress lactogenic hormone induction of the beta-casein gene
16947075 The RCM-kappa does form concentration-dependent micelles. Also, beta-CN phosphorylation level influences micelle formation. Complexes were low-temperature reversible and RCM-kappa fibrils were seen.
12788072 New functions of lactoferrin and beta-casein in mammalian milk as cysteine protease inhibitors. They might play a role in antiseptic and antiinfectious functions due to cysteine protease inhibition of bacteria and viruses.

AA Sequence

MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVE      1 - 70
PIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH     71 - 140
LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQI    141 - 210
YPVTQPLAPVHNPISV                                                          211 - 226
//

Text Mined References (25)

PMID Year Title
25087955 2014 Serotonin suppresses ?-casein expression via inhibition of the signal transducer and activator of transcription 5 (STAT5) protein phosphorylation in human mammary epithelial cells MCF-12A.
24364857 2014 The role of anionic peptide fragments in 1N4R human tau protein aggregation.
24189037 2014 Enhanced levels of immunoreactive ?-casomorphin-8 in milk of breastfeeding women with mastitis.
19463972 2009 Derivatives of human beta-casein fragments (54-59) exhibit highly potent immunosuppressant activity.
18847231 2008 Analysis of the human casein phosphoproteome by 2-D electrophoresis and MALDI-TOF/TOF MS reveals new phosphoforms.
16973758 2007 Progesterone receptor repression of prolactin/signal transducer and activator of transcription 5-mediated transcription of the beta-casein gene in mammary epithelial cells.
16947075 2006 Reconstituted micelle formation using reduced, carboxymethylated bovine kappa-casein and human beta-casein.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12788072 2003 New functions of lactoferrin and beta-casein in mammalian milk as cysteine protease inhibitors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12146463 2002 Suspension of the calcium-sensitive human beta-caseins by human kappa-casein.
10971580 2000 Characterization of human HtrA2, a novel serine protease involved in the mammalian cellular stress response.
9795185 1998 A distal enhancer region in the human beta-casein gene mediates the response to prolactin and glucocorticoid hormones.
9187653 1997 Structure of a specific acyl-enzyme complex formed between beta-casomorphin-7 and porcine pancreatic elastase.
8565637 1996 Assignment of the gene for beta-casein (CSN2) to 4q13 --> q21 in humans and 3p13 --> p12 in chimpanzees.
8112603 1994 Structure of the human beta-casein encoding gene.
7979373 1994 Kappa-casein and beta-caseins in human milk micelles: structural studies.
7698025 1995 A mapping study of 13 genes on human chromosome bands 4q11-->q25.
6715339 1984 Human beta-casein. Amino acid sequence and identification of phosphorylation sites.
2717418 1989 Human beta-casein: partial cDNA sequence and apparent polymorphism.
2387396 1990 Cloning and sequencing of a cDNA encoding human milk beta-casein.
1577486 1992 Regional localization of human beta-casein gene (CSN2) to 4pter-q21.
1382974 1992 A mammalian dual specificity protein kinase, Nek1, is related to the NIMA cell cycle regulator and highly expressed in meiotic germ cells.
1369431 1992 Plasmin cleavage of human beta-casein.