Property Summary

NCBI Gene PubMed Count 81
PubMed Score 853.76
PubTator Score 318.09

Knowledge Summary

Patent

No data available

Gene RIF (23)

PMID Text
24475273 Placental lactogen is expressed but is not translated into protein in breast cancer.
24408518 These results indicate that placental lactogen induces CYP2E1 expression via PI3-kinase pathway in human hepatocytes.
23744883 Expression of placental lactogen mRNA is increased in plasma of women with placenta previa and invasive placenta.
23465880 altered expression of placenta lactogen appears not to be causal for betamethasone-induced fetal growth restriction in the human
22387044 results are consistent with a pleiotropic effect of placental hGH/CSH genes at the maternal-fetal interface relating to the regulation of fetal growth and the risk of affected maternal metabolism.
21765243 hPL-A is involved in the regulation of pancreatic beta cells activity.
21737519 Data conclude that members of the C/EBP and Ets families can differentially modulate CS-Benh and CS-Aenh activity.
20427283 Results strongly support a conformationally mediated obligate-ordered prolactin receptor binding for each of the three lactogenic hormones: prolactin, growth hormone, and placental lactogen.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233782 The human growth hormone/chorionic somatomammotropin at chromosome 17 is implicated in regulation of postnatal and intrauterine growth.
19290844 maternal smoking associated with a reduction in cord blood hPL
19047151 Three single nucleotide polymorphisms in CGB5 and CSH1 genes were genotyped for 844 offspring of the cases and controls. Maternal breast cancer risk did not significantly differ by the offspring's carrier status of the three SNPs.
19047151 Observational study of gene-disease association. (HuGE Navigator)
18292525 Placental lactogen is a novel ligand of stabilin-1.
17400796 A CSH1 deletion carrier with nearly complete hypomethylation at the ICR1 locus had the characteristic clinical signs of Silver Russel syndrome, ruling out a causal relationship.
17125497 Observational study of gene-disease association. (HuGE Navigator)
16950818 The present findings indicate that the concentration of human placental lactogen (hPL) and human chorionic gonadotropin (beta hCG) mRNA is significantly higher in the cellular component of maternal blood samples than in the plasma component.
16546209 crystal structure of the free state of human PL has been determined to 2.0 A resolution showing the molecule possesses an overall structure similar to other long chain four-helix bundle cytokines
16410683 We showed that intra-arterial infusion of human placental lactogen primarily decreased coronary, renal & iliac blood flow. Mechanism of this response was shown to be due to inhibition of vasodilatory beta2-adrenergic receptor-mediated effect.
15531513 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14673137 These data implicate ETS-domain family members in the regulation of the CS locus in placenta and pituitary cells.
14642004 a role for CSH1 haploinsufficiency in the etiology of growth retardation
11897833 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.

AA Sequence

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF      1 - 70
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL     71 - 140
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (82)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24475273 2014 Placental lactogen is expressed but is not translated into protein in breast cancer.
24408518 2014 Human placental lactogen induces CYP2E1 expression via PI 3-kinase pathway in female human hepatocytes.
23744883 2014 Increased levels of cell-free human placental lactogen mRNA at 28-32 gestational weeks in plasma of pregnant women with placenta previa and invasive placenta.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23465880 2013 Growth restricting effects of a single course of antenatal betamethasone treatment and the role of human placental lactogen.
22387044 2012 Differential placental expression profile of human Growth Hormone/Chorionic Somatomammotropin genes in pregnancies with pre-eclampsia and gestational diabetes mellitus.
21765243 Human placental lactogen (hPL-A) activates signaling pathways linked to cell survival and improves insulin secretion in human pancreatic islets.
21737519 2011 Identification of functional CCAAT/enhancer-binding protein and Ets protein binding sites in the human chorionic somatomammotropin enhancer sequences.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20427283 2010 Obligate ordered binding of human lactogenic cytokines.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233782 2010 Differential expression profile of growth hormone/chorionic somatomammotropin genes in placenta of small- and large-for-gestational-age newborns.
19290844 2009 Effect of maternal smoking on cord blood estriol, placental lactogen, chorionic gonadotropin, FSH, LH, and cortisol.
19047151 2008 Do placental genes affect maternal breast cancer? Association between offspring's CGB5 and CSH1 gene variants and maternal breast cancer risk.
18473352 2008 Complex signatures of locus-specific selective pressures and gene conversion on Human Growth Hormone/Chorionic Somatomammotropin genes.
18292525 2008 Alternatively activated macrophages regulate extracellular levels of the hormone placental lactogen via receptor-mediated uptake and transcytosis.
17400796 2007 Hypomethylation in the 11p15 telomeric imprinting domain in a patient with Silver-Russell syndrome with a CSH1 deletion (17q24) renders a functional role of this alteration unlikely.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17125497 2006 A study of association between common variation in the growth hormone-chorionic somatomammotropin hormone gene cluster and adult fasting insulin in a UK Caucasian population.
16950818 2006 Measurement of mRNA of trophoblast-specific genes in cellular and plasma components of maternal blood.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16546209 2006 Crystal structure and site 1 binding energetics of human placental lactogen.
16410683 2006 Human placental lactogen decreases regional blood flow in anesthetized pigs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15713716 2005 Short stature caused by a biologically inactive mutant growth hormone (GH-C53S).
15531513 2004 Late life metabolic syndrome, early growth, and common polymorphism in the growth hormone and placental lactogen gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15001589 2004 A novel dysfunctional growth hormone variant (Ile179Met) exhibits a decreased ability to activate the extracellular signal-regulated kinase pathway.
14997482 2004 Identification and characterization of phosphorylated proteins in the human pituitary.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673137 2004 Binding of AP-2 and ETS-domain family members is associated with enhancer activity in the hypersensitive site III region of the human growth hormone/chorionic somatomammotropin locus.
14642004 2003 Characterization of genomic variants in CSH1 and GH2, two candidate genes for Silver-Russell syndrome in 17q24-q25.
12682290 2003 Placental mRNA in maternal plasma: prospects for fetal screening.
12655557 2003 Novel mutations of the growth hormone 1 (GH1) gene disclosed by modulation of the clinical selection criteria for individuals with short stature.
12644709 2003 mRNA of placental origin is readily detectable in maternal plasma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11897833 2002 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.
11502836 2001 Autosomal dominant GH deficiency due to an Arg183His GH-1 gene mutation: clinical and molecular evidence of impaired regulated GH secretion.
10966654 2000 Ternary complex between placental lactogen and the extracellular domain of the prolactin receptor.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9329365 1997 Selective growth hormone/placental lactogen gene transcription and hormone production in pre- and postmenopausal human ovaries.
9276733 1997 Biologically inactive growth hormone caused by an amino acid substitution.
9152628 1997 Detection of growth hormone gene defects by dideoxy fingerprinting (ddF).
8943276 1996 Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
8674830 1995 Splicing variants of the human growth hormone mRNA: detection in pituitary, mononuclear cells and dermal fibroblasts.
8552145 1996 Brief report: short stature caused by a mutant growth hormone.
7984244 1994 The X-ray structure of a growth hormone-prolactin receptor complex.
7462247 1981 The 20,000 molecular weight variant of human growth hormone. Preparation and some physical and chemical properties.
7356479 1980 The 20,000-dalton variant of human growth hormone: location of the amino acid deletions.
7169009 1982 The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone.
7028740 1981 Altered proteolytic cleavage of human growth hormone as a result of deamidation.
6930851 1980 Cotranslational sequestration of egg white proteins and placental lactogen inside membrane vesicles.
6300056 1983 Two structurally different genes produce the same secreted human placental lactogen hormone.
6269091 1981 Human growth hormone DNA sequence and mRNA structure: possible alternative splicing.
6209277 1984 Multiple origins of transcription for the human placental lactogen genes.
6208192 1984 Analysis of a major human chorionic somatomammotropin gene. Evidence for two functional promoter elements.
5810834 1969 Human pituitary growth hormone. XIX. The primary structure of the hormone.
5286363 1971 Amino-acid sequence of human placental lactogen.
5279528 1971 Sequences of pituitary and placental lactogenic and growth hormones: evolution from a primordial peptide by gene reduplication.
5279046 1971 Revised primary structure for human growth hormone.
5144027 1971 Human pituitary growth hormone. 32. The primary structure of the hormone: revision.
4712450 1973 Amino acid sequence of human chorionic somatomammotropin.
4675454 1972 Sequence comparison of human pituitary growth hormone, human chorionic somatomammotropin, and ovine pituitary growth and lactogenic hormones.
3912261 1985 Periplasmic production of correctly processed human growth hormone in Escherichia coli: natural and bacterial signal sequences are interchangeable.
3447173 1987 Prediction of the three-dimensional structure of human growth hormone.
3030680 1987 The human growth hormone gene locus: structure, evolution, and allelic variations.
2835050 1988 cDNA cloning of human chorionic somatomammotropin-1 mRNA whose transcription was initiated at the 5' region of the TATA box.
2744760 1989 The human growth hormone locus: nucleotide sequence, biology, and evolution.
1980158 1990 Hot spots for growth hormone gene deletions in homologous regions outside of Alu repeats.
1549776 1992 Human growth hormone and extracellular domain of its receptor: crystal structure of the complex.
1378436 1992 Developmental control and alternative splicing of the placentally expressed transcripts from the human growth hormone gene cluster.
611657 1977 Nucleotide sequence of a human gene coding for a polypeptide hormone.
593368 1977 Construction and analysis of recombinant DNA for human chorionic somatomammotropin.
438159 1979 Identification of the interchain disulfide bonds of dimeric human placental lactogen.
386281 1979 Molecular cloning and nucleotide sequence of the human growth hormone structural gene.
377496 1979 Human growth hormone: complementary DNA cloning and expression in bacteria.
71212 1977 Nucleotide sequence of part of the gene for human chorionic somatomammotropin: purification of DNA complementary to predominant mRNA species.