Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.35
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.095 1.5e-02
atypical teratoid / rhabdoid tumor 1.100 8.9e-04
ependymoma 1.300 1.8e-02
gastric carcinoma 1.500 1.3e-02
glioblastoma 1.100 9.8e-03
interstitial cystitis 1.100 1.8e-04
medulloblastoma, large-cell 1.400 4.2e-04
osteosarcoma 1.661 6.6e-05
ovarian cancer -1.700 6.6e-06
primary Sjogren syndrome 1.400 3.4e-03
progressive supranuclear palsy -1.100 2.8e-02
Rheumatoid arthritis 1.600 2.3e-03
ulcerative colitis 2.400 1.0e-05

Gene RIF (2)

AA Sequence

MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQALLQEQEEHYQT      1 - 70
RATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPSDLLEFLHSQIDKAEVSIGAKLP     71 - 140
SEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDELVEVIEAGLEVINNPDEDDEQEDEEGPLGEK    141 - 210
LIFNENDFVEGYYRTERDKGTQYELFFKKADLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAE    211 - 280
RTEAFVQFMQNFRDVCIHQDKKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLN    281 - 350
VGARAWDKGEVLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH    351 - 420
KKDSGFWRDFGFGMTCQYRSDFLTIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPGLFHLWHEKRC    421 - 490
ADELTPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEAVG                      491 - 542
//

Text Mined References (23)

PMID Year Title