Property Summary

NCBI Gene PubMed Count 198
PubMed Score 1339.46
PubTator Score 1302.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.700 2.0e-08
psoriasis -1.200 3.1e-03
glioblastoma 1.500 7.6e-06
medulloblastoma, large-cell 1.300 1.4e-04
lung cancer -4.300 4.9e-06
adult high grade glioma 1.300 7.8e-04
group 4 medulloblastoma -1.200 1.3e-04
pilocytic astrocytoma 1.100 1.1e-03
COPD -1.200 3.4e-02
lung carcinoma -1.500 1.8e-11

Protein-protein Interaction (1)

Gene RIF (151)

PMID Text
26686751 This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal.
26642091 peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R).
26376111 In patients with CLE, 100 and 150 mg PD-0360324 (monoclonal antibody against MCSF) every 2 weeks for 3 months suppressed a subset of circulating monocytes.
26359491 By identifying the M-CSFM residues critical for M-CSF-c-FMS interactions, we have laid down the basis for a deeper understanding of the M-CSF . c-FMS signaling mechanism
26245897 study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis
26235028 Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions.
26095744 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine
26029847 These findings highlight an essential role for PRKAA1-mediated autophagy during differentiation of human monocytes.
25935153 These findings suggest a high usefulness of M-CSF in diagnosing the serous sub-type of epithelial ovarian cancer and in discriminating between cancer and non-carcinoma lesions
25891874 Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease.
25854167 Determination of CSF1 and CSF1R expression may be useful as a prognosticator of the clinical course and/or outcomes of Pigmented villonodular synovitis .
25721620 Colony Stimulating Factors 1, 2, 3 and early pregnancy
25420919 FoxO1 is highly expressed in M-CSF-derived (M2-like) macrophage subsets, and this M2-like macrophages showed a preferential FoxO1 enrichment on the IL-10 promoter but not in GM-CSF-derived (M1-like) macrophages
25418473 RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25313137 results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways.
25196912 expression and release, from osteoblasts of macrophage colony-stimulating factor (M-CSF), which is indispensable for osteoclast differentiation, was inhibited by uPAR loss.
25138985 macrophage colony-stimulating factor (M-CSF) may be involved in the regulation of epiphyseal plate injury and repair in Kashin-Beck disease.
25066464 potent profibrotic factor in hepatitis C virus liver fibrosis
24956020 The aim of the present study was to assess the effect of soluble mediators produced by breast cancer cells on human osteoclast maturation in a co-culture model.
24769444 In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis.
24748497 The findings of this study regarding the unique functional interplay between M-CSF and IL-32 increase our understanding of the mechanisms that regulate the survival and M1/M2 ratio of macrophages, as well as HIV-1 replication in macrophages.
24604026 Findings suggest the replacement of the 3'-UTR of CSF1 with other sequences in tenosynovial giant cell tumors.
24592910 None of SNPs among rs333967, rs2297706 and rs1058885 in CSF-1 was found statistically significantly associated with CP in Han Chinese with Shanghai origin. haplotype T-C-G showed statistically significant association with decreased risk in males.
24178511 genetic polymorphism is associated with platelet counts
24157873 Regulation of immediate-early gene response by THOC5, a member of mRNA export complex contributes to the M-CSF-induced macrophage differentiation.
24016870 Elevated CSF1 serum level is associated with early breast cancer.
23924854 GPNMB expression was regulated by EpCAM and CSF-1 partly through their common downstream product c-myc
23870818 high expression correlates with shorter metastasis-free survival in non-small-cell lung cancer patients
23688065 The results indicate usefulness of VEGF and M-CSF in diagnostics of breast cancer patients, especially in combination with CA 15-3.
23684409 This study is the first to illustrate downstream transcriptional profiles and pathways of IL-34 in comparison with CSF-1 and identify notable differences in CCR2 expression.
23520016 The expression of CSF2 (but not CSF1) was highly up-regulated in glioblastoma patients and we found an inverse correlation between CSF2 expression and patient survival.
23471483 Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA.
23333304 HIV-1 Vif upregulates the expression of colony stimulating factor 1 (CSF1) in Vif-expression T cells
23285029 The percentage of CD14(high)CD16(+) monocytes after trauma correlated strongly with plasma C-reactive protein (CRP) transforming growth factor-beta (TGF-beta), and macrophage colony-stimulating factor (M-CSF) levels.
23260168 the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined.
23233531 miR-148b controls malignancy by coordinating a novel pathway involving over 130 genes and, in particular, it directly targets players of the integrin signaling, such as ITGA5, ROCK1, PIK3CA/p110alpha, and NRAS, as well as CSF1
23061794 M-CSF was shown to interact with Epstein-Barr virus-encoded BARF1 via the protruding N-terminal loops involving Val38 and Ala84.
22678116 Our results reveal a novel mechanism for the therapeutic function of fish oil diet that blocks miR-21, thereby increasing PTEN levels to prevent expression of CSF-1 in breast cancer.
22365076 Suggest that CSF-1 and its receptor, C-FMS, are involved in the genesis of early endometriotic lesions and that endometriotic lesions contribute to elevated CSF-1 levels in the peritoneal fluid of women with endometriosis.
22186992 Studies indicate that Macrophage-colony stimulating factor (CSF-1) signaling through its receptor (CSF-1R) promotes the differentiation of myeloid progenitors.
22082370 In this review, shedding of macrophage-CSF receptor c-Fms inhibits osteoclastogenesis.
22052465 results suggest that budding RCC stimulates the proximal adjacent microenvironment in the kidney to release mediators of CSF-1, CSF-1R, and epidermal growth factor expression in RCCs
22028782 CSF-1 dependent Erk activation and proliferation are regulated differentially in progenitors and differentiated cells
21945122 Macrophage Colony Stimulating Factor and Monocyte Chemoattractant Protein are elevated in sera of intrinsic asthmatics compared to normal controls.
21938481 Treatment of differentiating cells with alendronate or pamidronate decreases the expression of M-CSF, which enhances preosteoclast formation. These results suggest a new mechanism by which BPs inhibit osteoclastogenesis.
21895511 findings demonstrate that NF-kappaB induces M-CSF expression on a promoter level via multiple functional NF-kappaB binding sites
21854753 These findings suggest an important role for CSF1 and the resulting tumor-associated macrophage infiltration in the pathological neovascularization of leiomyosarcoma.
21791433 Humanized CSF-1 mice will be a valuable experimental model to study human myeloid cell biology.
21717212 These observations may indicate a pathogenetic role of Macrophage colony-stimulating factor in Hodgkin lymphoma.
21481374 CSF-1, in an autocrine fashion, has a direct effect on endometrial epithelial cell proliferation and attachment to peritoneal mesothelial cells, early steps in endometriosis lesion formation on the peritoneum.
21239715 M-CSF enhances dendritic cell DC-SIGN (CD209) expression on in vitro derived anti-inflammatory macrophages; M-CSF mediates induction of DC-SIGN by fibroblast- and tumor cell-conditioned media.
20925194 These results indicate that nuclear NFAT can activate CSF-1 gene transcription by connecting with the CSF-1 promoter in the signaling events induced by L-selectin ligation.
20869948 HIV-1 Vif upregulates the expression of colony stimulating factor 1 (CSF1) in Vif-expression T cells
20839921 Increased prevalence of M-CSF in the setting of HIV infection could contribute to neuronal injury and may be predictive of cognitive impairment.
20839008 genetic risk for Paget's disease of bone is associated with variants close to CSF1, OPTN, TM7SF4, and TNFRSF11A genes; most significant results are found in the CSF1 gene region
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20504948 The different spatiotemporal expression of IL-34 and CSF-1 allows for complementary activation of the CSF-1R in developing and adult tissues.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20455868 Macrophage colony-stimulating factor in CSF appears to be a biomarker for diagnosis of mild cognition disorder.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20436471 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20436471 These studies provide new insights into the pathogenesis of PDB and identify OPTN, CSF1 and TNFRSF11A as candidate genes for disease susceptibility.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19950360 possible local and systemic involvement of M-CSF in humans during fracture healing
19926892 serum and urine CSF-1 levels correlated with lupus activity, and intrarenal CSF-1 expression correlated with the histopathology activity index of lupus nephritis
19913121 Observational study of gene-disease association. (HuGE Navigator)
19711348 Studies demonstrated that increased CSF-1 production by host cells enhances TAM recruitment and NB growth.
19641137 M-CSF inhibits differentiation of murine bone marrow-derived macrophages into prefusion osteoclasts (pOC) in vitro, but induces fusion of pOCs to form multinucleated osteoclasts, making the osteoclast capable of bone resorption.
19561083 CSF-1-induced WASP activation was fully Cdc42-dependent.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19443701 CSF1 may play an important role in the clinical behavior of leiomyosarcoma
19432671 CSF-1 derived from tumor tissues induces macrophages to shift toward the M2 phenotype, which is considered to promote tumor growth
19196448 renal tubular cell derived m-CSF is a stimulus for monocyte activation
19017797 Calorimetric data indicate that M-CSF cannot dimerize FMS without receptor-receptor interactions mediated by FMS domains D4 and D5
19008293 CRP up-regulates M-CSF release from human monocyte-derived macrophages and human aortic endothelial cells and increased macrophage proliferation.
19004987 CSF-1 represents a further link between inflammation and cardiovascular disease.
18996518 Macrophage colony-stimulating factor is involved in follicle development and ovulation and could be an additional predictor for in vitro fertilization outcome.
18852899 ability of M-CSF to recruit mononuclear phagocytes, increase VEGF levels, and enhance angiogenesis
18751872 The close correlation between serum M-CSF and serum thyroid hormone levels suggests that high circulating levels of thyroid hormones may directly or indirectly potentiate the production of M-CSF in patients with GD.
18724005 These results suggest that orthodontic tooth movement causes an increase in VEGF and M-CSF levels, which may induce bone remodeling via osteoclastic bone resorption.
18718581 Report clinical use of colony-stimulating factor-1 in ovulation induction for poor responders.
18708368 GAPDH, a multifunctional protein, now adds regulation of mRNA stability to its repertoire.
18676750 CSF1, EGFR, and CA IX have roles in increasing survival in early-stage squamous cell carcinoma of the lung
18668547 CCL23, M-CSF, TNFRSF9, TNF-alpha, and CXCL13 are predictive of rheumatoid arthritis disease activity and may be useful in the definition of disease subphenotypes and in the measurement of response to therapy in clinical studies.
18632616 mM-CSF may be a critical linker between macrophages and malignant cells in the development of hematopoietic malignancies
18619508 nuclear c-Abl kinase can activate CSF-1 gene transcription by regulating AP-1 activity in the signaling events induced by L-selectin ligation.
18510570 Expression of M-CSF, CSF-1R and CD3 is a significant prognostic factor in primary prostatic cancers by predicting the development of metastases.
18467591 Discovered IL-34 and its receptor CSF1 by functional screening of the extracellular proteome.
18435789 Peripheral blood mononuclear cells (PBMCs) from periodontitis patients do not need priming by M-CSF to become osteoclast-like cells, suggesting that PBMCs from periodontitis patients are present in the circulation in a different state of activity.
18322228 CSF-1 stimulates extracellular signal-regulated kinase 5 (ERK5) activation in macrophages.
18219369 Differential constitutive and cytokine-modulated expression of Toll-like receptors in primary neutrophils, monocytes, and macrophages is reported.
17967422 CSF-1 and TPA use independent pathways to initiate RIPping, and that the intracellular domain is targeted for degradation through ubiquitination
17922812 Human cardiac cells constitutively express M-CSF and its expression is up-regulated by TNF-alpha.
17918257 Csf1 fusion with collagen type VI alpha-3 gene is associated with tenosynovial giant cell tumors.
17916748 M-CSF-driven generation of plasmacytoid dendritic cells and conventional dendritic cells in vitro and in vivo was independent of endogenous Flt-3 ligand
17907802 HIV-1 Vif upregulates the expression of colony stimulating factor 1 (CSF1) in Vif-expression T cells
17589498 Monocytopoiesis is controlled by a circuitry involving sequentially miRNA 17-5p-20a-106a, AML1 and M-CSFR, whereby miRNA 17-5p-20a-106a function as a master gene complex interlinked with AML1 in a mutual negative feedback loop.
17532041 We have shown for the first time that a homeobox gene, HLX1, is a downstream effector gene of CSF-1, that HLX1 regulates placental cell proliferation and that CSF-1 acts, at least in part, through HLX1 to control cell proliferation.
17516513 M-CSF modulates osteoclast-resorbing activity, but is not required for cell survival
17443671 Increased and prolonged ERK activation led to M-CSF-mediated macrophage differentiation but not to proliferation.
17431224 macrophage colony-stimulating factor(M-CSF) contributes to the pathogenesis of pulmonary fibrosis in patients with IPF through the involvement of mononuclear phagocytes and CCL2 production.
17420255 a combination of the Src family kinase, phosphatidylinositol 3-kinase/Akt, phospholipase C, and ERK pathways mediates macrophage proliferation in response to M-CSF
17368603 Significantly higher macrophage-colony stimulating factor level is associated with lymph node metastasis in colorectal cancer patients
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17243911 significantly higher levels of macrophage-colony stimulating factor is associated with pancreatic cancer
17192722 Observational study of gene-disease association. (HuGE Navigator)
17192722 These data do not support the hypothesis that genetic variability of CSF1 influences the risk for Alzheimer's disease (AD).
17108334 CSF1 is involved in regulating macrophage trafficking at the fetal-maternal interface
16951369 Different individual CSF-1 isoforms regulate the frequency of activated macrophages in the kidney during experimental unilateral ureteral obstruction.
16859503 IL-10 may contribute to the inflammatory process by facilitating monocyte differentiation into TNF-alpha-responsive macrophages in the presence of M-CSF in rheumatoid arthritis.
16844084 Observational study of gene-disease association. (HuGE Navigator)
16844084 three polymorphisms located in the colony stimulating factor 1 (CSF1) gene showed a positive association with aggressive periodontitis
16673212 at 35 and 38 weeks, the Macrophage colony-stimulating factor (M-CSF) levels were significantly higher in twin pregnancy than in singleton pregnancy
16407111 Fusion with COL6A3 overexpresses CSF1, found in some but not all cells in tenosynovial giant-cell tumor and pigmented villonodular synovitis.
16320327 Nurse-like cells are involved in rheumatoid arthritis-induced bone destruction by maintaining osteoclast precursors via production of M-CSF.
16318581 MCP-1 and M-CSF, critical for monocyte recruitment, activation, and differentiation, differentially regulate VEGF-A expression and may play an important role in monocyte/macrophage- mediated tumor angiogenesis
16267391 INI1/hSNF5/BAF47 functions in activation of the colony stimulating factor 1 (CSF1) promoter in HeLa cells.
16204228 catalase has a critical role in CSF-independent survival of human macrophages via regulation of the expression of BCL-2 and BCL-XL
15944252 M-CSF enhances tumor growth in mice by increasing endothelial progenitor cells and activating angiogenesis; the effects of M-CSF are largely based on the induction of systemic VEGF from skeletal muscles.
15919699 Uncreased macrophage colony stimulating factor is associated with the process of atherosclerosis in hemodialysis patients
15866728 The M-CSF gene was cloned into baculovirus transfer vector pVL1392 under the control of polyhedrin promoter and expressed in the Sf9 cells (Spodoptera frugiperda).
15820145 indicate novel roles of M-CSF in articular cartilage metabolism in collaboration with CTGF/CCN2, particularly during an inflammatory response
15728521 Serum M-CSF levels are markedly increased in Langerhans cell histiocytosis patients who, in addition to bone disease, also show skin or lymph node involvement.
15640942 A significant serum tumor marker in head and neck squamous cell carcinoma.
15624698 Interferon-gamma stimulates transcription of the CSF-1 gene through this sequence, which binds STAT1
15576295 The MGFS mRNA expression in these cell lines and recent studies have demonstrated that HCs can stimulate tumor progression.
15494511 Crystal structures of HLA-B*3501 in complex with 14-mer macrophage-colony stimulating factor peptide reveal that the antigenic peptide follows the general rules of major histocompatibility complex binding.
15358207 In vitro human osteoclastogenesis is dependent on M-CSF and the stimulatory effects of GM-CSF are mediated by M-CSF.
15261158 results suggest that nuclear actin plays a role in regulating CSF-1 gene transcription, and this role does not depend on actin polymerization
15256272 Expreeeion of macrophage colony-stimulating factor in human osteoblast-like cells is suppressed by arginine-vasopressin.
15116247 red blood cells from diabetic patients induced an increase in MCSF and VCAM1 expression in HUVEC cells, mediated by AGE-RAGE interaction
15001836 The serum M-CSF concentration could be of interest as a tumor marker in squamous cell carcinomas of the head and neck.
14654075 findings of co-expression of KIT and/or FMS with their respective ligands implies these receptors might contribute to leukemogenesis in some patients with AML through autocrine, paracrine, or intracrine interactive stimulation.
14634568 Increase in serum M-CSF levels precedes development of preeclampsia. Elevation of serum M-CSF supports M-CSF elevation in placenta. This elevation at 18 weeks of gestation may be related to placental hypoxia, considered cause of preeclampsia.
14605992 increased levels of serum macrophage colony stimulating factor markedly precede the development of clinical manifestations of preeclampsia
12929928 sCSF-1 is a key determinant of bone cell activity in the corticoendosteal envelope
12928417 Monocytes promote angiogenesis via M-CSF-induced vascular endothelial growth factor production.
12894871 CSF1 has a role in regulating macrophage activation [review]
12890905 Serum VEGF concentration was increased in arteriosclerosis obliterans (ASO) and thromboangitis obliterans, but increased concentration of M-CSF was seen only in ASO.
12865350 findings directly support the conclusion that membrane-bound colony stimulating factor-1 is functionally active in bone in vivo
12684699 Results suggest that macrophage colony-stimulating factor may autoregulate functional cellular subpopulations of human endometrial stromal cells in an autocrine or a paracrine manner.
12548211 macrophage colony-stimulating factor increased platelet-activating factor acetylhydrolase secretion by decidual macrophages
12501178 Time-dependent folding events reveal that recombinant MCSF beta molecules pass through both monomeric and dimeric intermediate states, suggesting that the denatured and dimeric bond-reduced protein folds via multiple pathways.
12456016 in human tumor cells, HGF and M-CSF stimulate osteopontin production (which is subsequently used as a substrate for cell adhesion)
12393446 IFN-gamma shifts monocyte differentiation to macrophages rather than DCs through autocrine M-CSF and IL-6 production.
12372416 CSF-1 and its receptor are regulated by 1,25(OH)(2)D(3) and its analogue tacalcitol in human monocytes which parallels the inhibition of differentiation into dendritic cells without altering survival
12032835 Opposite effects of different doses of MCSF on ERK phosphorylation and cell proliferation in macrophages.
11843897 High M-CSF levels may correlate with cellular or organ damage in patients treated with peripheral blood stem cell transplantation for hematologic diseases.
11792569 Macrophage colony-stimulating factor and receptor activator NF-kappaB ligand fail to rescue osteoclast-poor human malignant infantile osteopetrosis in vitro.

AA Sequence

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV      1 - 70
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE     71 - 140
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP    141 - 210
LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP    211 - 280
RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL    281 - 350
PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS    351 - 420
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFS    421 - 490
PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV          491 - 554
//

Text Mined References (209)

PMID Year Title
26686751 2016 3-D individual cell based computational modeling of tumor cell-macrophage paracrine signaling mediated by EGF and CSF-1 gradients.
26642091 2016 Injured sensory neuron-derived CSF1 induces microglial proliferation and DAP12-dependent pain.
26376111 2016 Monoclonal antibody against macrophage colony-stimulating factor suppresses circulating monocytes and tissue macrophage function but does not alter cell infiltration/activation in cutaneous lesions or clinical outcomes in patients with cutaneous lupus erythematosus.
26359491 2015 Combinatorial and Computational Approaches to Identify Interactions of Macrophage Colony-stimulating Factor (M-CSF) and Its Receptor c-FMS.
26245897 2015 Glioblastoma-derived Macrophage Colony-stimulating Factor (MCSF) Induces Microglial Release of Insulin-like Growth Factor-binding Protein 1 (IGFBP1) to Promote Angiogenesis.
26235028 2015 Structure and Assembly Mechanism of the Signaling Complex Mediated by Human CSF-1.
26095744 2015 IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26029847 2015 The PRKAA1/AMPK?1 pathway triggers autophagy during CSF1-induced human monocyte differentiation and is a potential target in CMML.
25935153 2015 M-CSF in a new biomarker panel with HE4 and CA 125 in the diagnostics of epithelial ovarian cancer patients.
25891874 2015 Polymorphisms of CSF1 and TM7SF4 genes in a case of mild juvenile Paget's disease found using next-generation sequencing.
25854167 2015 Expression of colony-stimulating factor 1 is associated with occurrence of osteochondral change in pigmented villonodular synovitis.
25721620 2015 Colony Stimulating Factors 1, 2, 3 and early pregnancy steps: from bench to bedside.
25420919 2015 Distinct role of FoxO1 in M-CSF- and GM-CSF-differentiated macrophages contributes LPS-mediated IL-10: implication in hyperglycemia.
25418473 2015 Response gene to complement 32 (RGC-32) expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25416956 2014 A proteome-scale map of the human interactome network.
25313137 2014 Vav1 promotes lung cancer growth by instigating tumor-microenvironment cross-talk via growth factor secretion.
25196912 2015 Urokinase receptor mediates osteoclastogenesis via M-CSF release from osteoblasts and the c-Fms/PI3K/Akt/NF-?B pathway in osteoclasts.
25138985 2014 Serum levels of M-CSF, RANKL and OPG in rats fed with Kashin-Beck disease-affected diet.
25066464 2014 IL-34 and macrophage colony-stimulating factor are overexpressed in hepatitis C virus fibrosis and induce profibrotic macrophages that promote collagen synthesis by hepatic stellate cells.
24956020 2014 CSF-1 blockade impairs breast cancer osteoclastogenic potential in co-culture systems.
24769444 2014 NCOA1 Directly Targets M-CSF1 Expression to Promote Breast Cancer Metastasis.
24748497 2014 M-CSF inhibits anti-HIV-1 activity of IL-32, but they enhance M2-like phenotypes of macrophages.
24604026 2014 Novel CSF1-S100A10 fusion gene and CSF1 transcript identified by RNA sequencing in tenosynovial giant cell tumors.
24592910 2014 The association of CSF-1 gene polymorphism with chronic periodontitis in the Han Chinese population.
24178511 2013 Gene-centric association signals for haemostasis and thrombosis traits identified with the HumanCVD BeadChip.
24157873 2013 Transcriptional regulation of immediate-early gene response by THOC5, a member of mRNA export complex, contributes to the M-CSF-induced macrophage differentiation.
24016870 2013 Elevated CSF1 serum concentration predicts poor overall survival in women with early breast cancer.
23924854 2013 Upregulation of glycoprotein nonmetastatic B by colony-stimulating factor-1 and epithelial cell adhesion molecule in hepatocellular carcinoma cells.
23870818 2013 Main histologic types of non-small-cell lung cancer differ in expression of prognosis-related genes.
23834954 2013 Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy.
23688065 2013 VEGF, M-CSF and CA 15-3 as a new tumor marker panel in breast malignancies: a multivariate analysis with ROC curve.
23684409 2013 Transcriptional profiling and pathway analysis of CSF-1 and IL-34 effects on human monocyte differentiation.
23520016 2013 Distinct roles of CSF family cytokines in macrophage infiltration and activation in glioma progression and injury response.
23471483 2013 Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285029 2012 Transforming growth factor-?, macrophage colony-stimulating factor and C-reactive protein levels correlate with CD14(high)CD16+ monocyte induction and activation in trauma patients.
23260168 2013 Cloning and expression of feline colony stimulating factor receptor (CSF-1R) and analysis of the species specificity of stimulation by colony stimulating factor-1 (CSF-1) and interleukin-34 (IL-34).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23233531 2013 miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23061794 2012 Epstein-Barr virus-encoded BARF1 protein is a decoy receptor for macrophage colony stimulating factor and interferes with macrophage differentiation and activation.
22678116 2012 miR-21 is targeted by omega-3 polyunsaturated fatty acid to regulate breast tumor CSF-1 expression.
22365076 2012 Increased expression of macrophage colony-stimulating factor and its receptor in patients with endometriosis.
22186992 2012 Therapeutic applications of macrophage colony-stimulating factor-1 (CSF-1) and antagonists of CSF-1 receptor (CSF-1R) signaling.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22082370 2011 Feedback inhibition of osteoclastogenesis during inflammation by IL-10, M-CSF receptor shedding, and induction of IRF8.
22052465 2012 Autocrine CSF-1 and CSF-1 receptor coexpression promotes renal cell carcinoma growth.
22028782 2011 The role of atypical protein kinase C in CSF-1-dependent Erk activation and proliferation in myeloid progenitors and macrophages.
21945122 2011 Macrophage colony stimulating factor and monocyte chemoattractant protein 2 are elevated in intrinsic asthmatics.
21938481 2012 Bisphosphonates modulate the expression of OPG and M-CSF in hMSC-derived osteoblasts.
21895511 2012 Macrophage colony stimulating factor regulation by nuclear factor kappa B: a relevant pathway in human immunodeficiency virus type 1 infected macrophages.
21854753 2011 CSF1 expression in nongynecological leiomyosarcoma is associated with increased tumor angiogenesis.
21791433 2011 Efficient differentiation and function of human macrophages in humanized CSF-1 mice.
21717212 2012 Serum macrophage colony-stimulating factor (M-CSF) in patients with Hodgkin lymphoma.
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
21481374 2011 Colony-stimulating factor-1 exerts direct effects on the proliferation and invasiveness of endometrial epithelial cells.
21239715 2011 Dendritic cell-specific ICAM-3-grabbing nonintegrin expression on M2-polarized and tumor-associated macrophages is macrophage-CSF dependent and enhanced by tumor-derived IL-6 and IL-10.
20925194 2010 NFAT regulates CSF-1 gene transcription triggered by L-selectin crosslinking.
20839921 2010 Exploring the relationship of macrophage colony-stimulating factor levels on neuroaxonal metabolism and cognition during chronic human immunodeficiency virus infection.
20839008 2010 The majority of the genetic risk for Paget's disease of bone is explained by genetic variants close to the CSF1, OPTN, TM7SF4, and TNFRSF11A genes.
20829061 2010 Macrophage-colony stimulating factor and interleukin-34 induce chemokines in human whole blood.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20504948 2010 Functional overlap but differential expression of CSF-1 and IL-34 in their CSF-1 receptor-mediated regulation of myeloid cells.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20455868 2010 Macrophage colony-stimulating factor (M-CSF) in plasma and CSF of patients with mild cognitive impairment and Alzheimer's disease.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20436471 2010 Genome-wide association study identifies variants at CSF1, OPTN and TNFRSF11A as genetic risk factors for Paget's disease of bone.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19950360 2010 Elevated levels of macrophage colony-stimulating factor in human fracture healing.
19934330 2009 Invasion of human breast cancer cells in vivo requires both paracrine and autocrine loops involving the colony-stimulating factor-1 receptor.
19926892 2009 Circulating CSF-1 promotes monocyte and macrophage phenotypes that enhance lupus nephritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19711348 2010 Stromal cell-derived CSF-1 blockade prolongs xenograft survival of CSF-1-negative neuroblastoma.
19641137 2009 GM-CSF regulates fusion of mononuclear osteoclasts into bone-resorbing osteoclasts by activating the Ras/ERK pathway.
19561083 2009 The mechanism of CSF-1-induced Wiskott-Aldrich syndrome protein activation in vivo: a role for phosphatidylinositol 3-kinase and Cdc42.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19443701 2009 Coordinate expression of colony-stimulating factor-1 and colony-stimulating factor-1-related proteins is associated with poor prognosis in gynecological and nongynecological leiomyosarcoma.
19432671 2009 Detection of M2 macrophages and colony-stimulating factor 1 expression in serous and mucinous ovarian epithelial tumors.
19196448 2009 Renal epithelial cell-derived monocyte colony stimulating factor as a local informant of renal injury and means of monocyte activation.
19100238 2009 Induction of STAP-1 promotes neurotoxic activation of microglia.
19017797 2008 Structure of macrophage colony stimulating factor bound to FMS: diverse signaling assemblies of class III receptor tyrosine kinases.
19008293 2009 C-reactive protein induces M-CSF release and macrophage proliferation.
19004987 2009 Colony-stimulating factor-1 (CSF-1) delivers a proatherogenic signal to human macrophages.
18996518 2010 Circulating level of macrophage colony-stimulating factor can be predictive for human in vitro fertilization outcome.
18852899 2008 M-CSF signals through the MAPK/ERK pathway via Sp1 to induce VEGF production and induces angiogenesis in vivo.
18751872 2008 Increased macrophage colony-stimulating factor levels in patients with Graves' disease.
18724005 2008 VEGF and M-CSF levels in periodontal tissue during tooth movement.
18718581 2008 Clinical use of colony-stimulating factor-1 in ovulation induction for poor responders.
18708368 2008 The multifunctional protein glyceraldehyde-3-phosphate dehydrogenase is both regulated and controls colony-stimulating factor-1 messenger RNA stability in ovarian cancer.
18687298 2008 Macrophage colony stimulating factor: not just for macrophages anymore! A gateway into complex biologies.
18676750 2008 Three-gene expression signature predicts survival in early-stage squamous cell carcinoma of the lung.
18668547 2008 Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor.
18632616 2008 A special linker between macrophage and hematopoietic malignant cells: membrane form of macrophage colony-stimulating factor.
18619508 2008 L-selectin ligation-induced CSF-1 gene transcription is regulated by AP-1 in a c-Abl kinase-dependent manner.
18606301 2008 Human osteoclast-poor osteopetrosis with hypogammaglobulinemia due to TNFRSF11A (RANK) mutations.
18566389 2008 Peroxisome proliferator-activated receptor-gamma regulates the expression of alveolar macrophage macrophage colony-stimulating factor.
18510570 2008 The prognostic impact of M-CSF, CSF-1 receptor, CD68 and CD3 in prostatic carcinoma.
18467591 2008 Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.
18435789 2008 Formation of osteoclast-like cells from peripheral blood of periodontitis patients occurs without supplementation of macrophage colony-stimulating factor.
18322228 2008 ERK5/BMK1 is indispensable for optimal colony-stimulating factor 1 (CSF-1)-induced proliferation in macrophages in a Src-dependent fashion.
18219369 2008 Differential constitutive and cytokine-modulated expression of human Toll-like receptors in primary neutrophils, monocytes, and macrophages.
17967422 2007 CSF-1 and TPA stimulate independent pathways leading to lysosomal degradation or regulated intramembrane proteolysis of the CSF-1 receptor.
17922812 2007 Macrophage colony stimulating factor expression in human cardiac cells is upregulated by tumor necrosis factor-alpha via an NF-kappaB dependent mechanism.
17918257 2008 Molecular identification of COL6A3-CSF1 fusion transcripts in tenosynovial giant cell tumors.
17916748 2008 M-CSF: a novel plasmacytoid and conventional dendritic cell poietin.
17589498 2007 MicroRNAs 17-5p-20a-106a control monocytopoiesis through AML1 targeting and M-CSF receptor upregulation.
17532041 2007 Homeobox gene HLX1 is a regulator of colony stimulating factor-1 dependent trophoblast cell proliferation.
17516513 2007 Multiple roles of M-CSF in human osteoclastogenesis.
17443671 2007 M-CSF-mediated macrophage differentiation but not proliferation is correlated with increased and prolonged ERK activation.
17431224 2007 Important roles for macrophage colony-stimulating factor, CC chemokine ligand 2, and mononuclear phagocytes in the pathogenesis of pulmonary fibrosis.
17420255 2007 c-Fms tyrosine 559 is a major mediator of M-CSF-induced proliferation of primary macrophages.
17368603 2007 Serum macrophage-colony stimulating factor levels in colorectal cancer patients correlate with lymph node metastasis and poor prognosis.
17355643 2007 Frequencies of single nucleotide polymorphisms in genes regulating inflammatory responses in a community-based population.
17244792 2007 Induction of dendritic cell-like phenotype in macrophages during foam cell formation.
17243911 2007 Serum levels of granulocyte colony-stimulating factor (G-CSF) and macrophage colony-stimulating factor (M-CSF) in pancreatic cancer patients.
17192722 2006 Genetic association study on colony-stimulating factor 1 in Alzheimer's disease.
17108334 2007 Differential regulation of colony stimulating factor 1 and macrophage migration inhibitory factor expression by inflammatory cytokines in term human decidua: implications for macrophage trafficking at the fetal-maternal interface.
16951369 2006 Distinct in vivo roles of colony-stimulating factor-1 isoforms in renal inflammation.
16859503 2006 Induction of tumour necrosis factor receptor-expressing macrophages by interleukin-10 and macrophage colony-stimulating factor in rheumatoid arthritis.
16844084 2006 CSF1 gene associated with aggressive periodontitis in the Japanese population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16673212 2006 Serum levels of macrophage colony-stimulating factor in singleton and twin pregnancy.
16407111 2006 A landscape effect in tenosynovial giant-cell tumor from activation of CSF1 expression by a translocation in a minority of tumor cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337366 2006 Colony-stimulating factor-1 in immunity and inflammation.
16320327 2005 Nurse-like cells from patients with rheumatoid arthritis support the survival of osteoclast precursors via macrophage colony-stimulating factor production.
16318581 2005 Paracrine regulation of vascular endothelial growth factor--a expression during macrophage-melanoma cell interaction: role of monocyte chemotactic protein-1 and macrophage colony-stimulating factor.
16267391 2005 Chromatin-remodeling factor INI1/hSNF5/BAF47 is involved in activation of the colony stimulating factor 1 promoter.
16204228 2005 Catalase plays a critical role in the CSF-independent survival of human macrophages via regulation of the expression of BCL-2 family.
15944252 2005 Macrophage colony-stimulating factor induces vascular endothelial growth factor production in skeletal muscle and promotes tumor angiogenesis.
15919699 2005 Predictive value of serum macrophage colony-stimulating factor for development of aortic calcification in haemodialysis patients: a 6 year longitudinal study.
15866728 2005 Expression of a novel recombinant stem cell factor/macrophage colony-stimulating factor fusion protein in baculovirus-infected insect cells.
15820145 2005 Collaborative action of M-CSF and CTGF/CCN2 in articular chondrocytes: possible regenerative roles in articular cartilage metabolism.
15728521 2005 Increased blood myeloid dendritic cells and dendritic cell-poietins in Langerhans cell histiocytosis.
15640942 2004 Significant correlation of matrix metalloproteinase and macrophage colony-stimulating factor serum concentrations in patients with head and neck cancer.
15624698 2004 A mechanism of transcriptional regulation of the CSF-1 gene by interferon-gamma.
15576295 2004 Hematopoietic cytokines as tumor markers.
15519852 2004 CSF-1 regulation of the wandering macrophage: complexity in action.
15494511 2004 Conformational restraints and flexibility of 14-meric peptides in complex with HLA-B*3501.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358207 2004 GM-CSF cannot substitute for M-CSF in human osteoclastogenesis.
15304486 2004 Essential role of p38 mitogen-activated protein kinase in cathepsin K gene expression during osteoclastogenesis through association of NFATc1 and PU.1.
15261158 2004 Unpolymerized nuclear actin is involved in the activation of CSF-1 gene transcription.
15256272 2004 Arg-vasopressin increases proliferation of human osteoblast-like cells and decreases production of interleukin-6 and macrophage colony-stimulating factor.
15116247 2004 AGEs, macrophage colony stimulating factor and vascular adhesion molecule blood levels are increased in patients with diabetic microangiopathy.
15001836 Macrophage colony-stimulating factor as a tumor marker for squamous cell carcinoma of the head and neck.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654075 2004 Lack of KIT or FMS internal tandem duplications but co-expression with ligands in AML.
14634568 2003 Elevation of serum macrophage colony-stimulating factor before the clinical manifestations of preeclampsia.
14605992 2003 Increased levels of serum macrophage colony-stimulating factor before the onset of preeclampsia.
12929928 2003 Osteoblast-specific targeting of soluble colony-stimulating factor-1 increases cortical bone thickness in mice.
12928417 2003 M-CSF induces vascular endothelial growth factor production and angiogenic activity from human monocytes.
12894871 2003 CSF-1 as a regulator of macrophage activation and immune responses.
12890905 2003 Serum concentrations of vascular endothelial growth factor and monocyte-colony stimulating factor in peripheral arterial disease.
12865350 2003 The cell surface form of colony-stimulating factor-1 is biologically active in bone in vivo.
12790839 2003 Serum levels of macrophage colony-stimulating factor after cesarean section, vaginal delivery, or laparotomy in normal pregnant women and gynecologic patients.
12749918 2003 PDGF BB and bFGF stimulate DNA synthesis and upregulate CSF-1 and MCP-1 gene expression in dental follicle cells.
12684699 2003 Regulation of the cellular subpopulation ratios of normal human endometrial stromal cells by macrophage colony-stimulating factor.
12548211 2003 Effects of colony-stimulating factors on the secretion of platelet-activating factor acetylhydrolase by human decidual macrophages.
12501178 2002 Conformational analysis of intermediates involved in the in vitro folding pathways of recombinant human macrophage colony stimulating factor beta by sulfhydryl group trapping and hydrogen/deuterium pulsed labeling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456016 HGF and M-CSF modulate adhesion of MDA-231 breast cancer cell by increasing osteopontin secretion.
12411027 2002 [Expression of macrophage colony-stimulating factor in human luteinized granulosa cells].
12393446 2003 Interferon-gamma switches monocyte differentiation from dendritic cells to macrophages.
12372416 2002 Vitamin D(3) and analogues modulate the expression of CSF-1 and its receptor in human dendritic cells.
11843897 2002 Fluctuations in plasma macrophage colony-stimulating factor levels during autologous peripheral blood stem cell transplantation for haematologic diseases.
11792569 2002 Macrophage colony-stimulating factor and receptor activator NF-kappaB ligand fail to rescue osteoclast-poor human malignant infantile osteopetrosis in vitro.
11739737 2002 Gab3, a new DOS/Gab family member, facilitates macrophage differentiation.
11387343 2001 Overexpression of macrophage colony-stimulating factor receptor on microglial cells induces an inflammatory response.
11369790 2001 An alternative open reading frame of the human macrophage colony-stimulating factor gene is independently translated and codes for an antigenic peptide of 14 amino acids recognized by tumor-infiltrating CD8 T lymphocytes.
11297560 2001 Suppressor of cytokine signaling 1 interacts with the macrophage colony-stimulating factor receptor and negatively regulates its proliferation signal.
11248655 2001 The effect of macrophage-colony stimulating factor and other humoral factors (interleukin-1, -3, -6, and -11, tumor necrosis factor-alpha, and granulocyte macrophage-colony stimulating factor) on human osteoclast formation from circulating cells.
10857771 2000 Effect of cytokines and growth factors on the macrophage colony-stimulating factor secretion by human bone marrow stromal cells.
10666185 2000 The CXC-chemokine platelet factor 4 promotes monocyte survival and induces monocyte differentiation into macrophages.
10652277 2000 Antiapoptotic activity of Stat5 required during terminal stages of myeloid differentiation.
9632647 1998 Human monocyte-derived macrophages secrete two forms of proteoglycan-macrophage colony-stimulating factor that differ in their ability to bind low density lipoproteins.
9147389 1997 The promoter of macrophage colony-stimulating factor receptor is active in astrocytes.
9131001 1997 Colony-forming cells expressing high levels of CD34 are the main targets for granulocyte colony-stimulating factor and macrophage colony-stimulating factor in the human fetal liver.
8981357 1997 Biology and action of colony--stimulating factor-1.
8804363 1996 Glomerular expression of macrophage colony-stimulating factor and granulocyte-macrophage colony-stimulating factor in patients with various forms of glomerulonephritis.
8422357 1993 Assignment of the inter- and intramolecular disulfide linkages in recombinant human macrophage colony stimulating factor using fast atom bombardment mass spectrometry.
8355686 1993 Identification of the ligand-binding regions in the macrophage colony-stimulating factor receptor extracellular domain.
8336080 1993 Analysis of the synergistic stimulation of mouse macrophage proliferation by macrophage colony-stimulating factor (CSF-1) and tumor necrosis factor alpha (TNF-alpha).
8262907 1993 The structure of recombinant human carboxy-terminal-truncated macrophage colony-stimulating factor derived from mammalian cells.
8086034 Colony stimulating factor-1 expression in human glioma.
7696959 1994 The biology and action of colony stimulating factor-1.
3500041 1987 Human CSF-1: gene structure and alternative splicing of mRNA precursors.
3498652 1987 Macrophage colony-stimulating factor purified from normal human urine. Amino-terminal sequence and amino acid composition.
3493529 1987 Human CSF-1: molecular cloning and expression of 4-kb cDNA encoding the human urinary protein.
3264878 1988 Expression and processing of a recombinant human macrophage colony-stimulating factor in mouse cells.
3264877 1988 Differential processing of colony-stimulating factor 1 precursors encoded by two human cDNAs.
3259875 1988 Macrophage colony-stimulating factor is produced by human T lymphoblastoid cell line, CEM-ON: identification by amino-terminal amino acid sequence analysis.
3039346 1987 Synthesis of membrane-bound colony-stimulating factor 1 (CSF-1) and downmodulation of CSF-1 receptors in NIH 3T3 cells transformed by cotransfection of the human CSF-1 and c-fms (CSF-1 receptor) genes.
2996129 1985 Molecular cloning of a complementary DNA encoding human macrophage-specific colony-stimulating factor (CSF-1).
2660794 1989 Amino-terminal region of human macrophage colony-stimulating factor (M-CSF) is sufficient for its in vitro biological activity: molecular cloning and expression of carboxyl-terminal deletion mutants of human M-CSF.
2460758 1988 Human macrophage-colony stimulating factor: alternative RNA and protein processing from a single gene.
2408759 1985 The c-fms proto-oncogene product is related to the receptor for the mononuclear phagocyte growth factor, CSF-1.
2145044 1990 Direct stimulation of cells expressing receptors for macrophage colony-stimulating factor (CSF-1) by a plasma membrane-bound precursor of human CSF-1.
1791839 1991 Expression of colony-stimulating factor-1 (CSF-1) messenger RNA in human endometrial glands during the menstrual cycle: molecular cloning of a novel transcript that predicts a cell surface form of CSF-1.
1739124 1992 Macrophage colony-stimulating factor gene expression in vascular cells and in experimental and human atherosclerosis.
1733926 1992 The predominant form of secreted colony stimulating factor-1 is a proteoglycan.
1571567 1992 Macrophage colony-stimulating factor is produced by activated T lymphocytes in vitro and is detected in vivo in T cells from reactive lymph nodes.
1540160 1992 Reassignment of the human macrophage colony stimulating factor gene to chromosome 1p13-21.
1531650 1992 Identification of a high molecular weight macrophage colony-stimulating factor as a glycosaminoglycan-containing species.
1455231 1992 Three-dimensional structure of dimeric human recombinant macrophage colony-stimulating factor.