Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.78
PubTator Score 8.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.800 1.1e-02
posterior fossa group B ependymoma -1.400 1.7e-05
glioblastoma -1.200 1.3e-03
sonic hedgehog group medulloblastoma -1.500 1.6e-03
adrenocortical carcinoma -1.562 3.7e-03
aldosterone-producing adenoma -1.384 2.1e-02
psoriasis -1.200 9.6e-17

Synonym

Accession Q9Y534 Q8ND37
Symbols PIPPIN
dJ347H13.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK      1 - 70
GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH     71 - 140
TPHETWSGQVVGS                                                             141 - 153
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12801884 2003 CRHSP-24 phosphorylation is regulated by multiple signaling pathways in pancreatic acinar cells.
12767259 RNA-binding ability of PIPPin requires the entire protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10923677 2000 Specific neurons of brain cortex and cerebellum are PIPPin positive.
10591208 1999 The DNA sequence of human chromosome 22.
10446180 1999 PIPPin is a brain-specific protein that contains a cold-shock domain and binds specifically to H1 degrees and H3.3 mRNAs.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8573167 1996 PIPPin, a putative RNA-binding protein specifically expressed in the rat brain.