Property Summary

NCBI Gene PubMed Count 9
PubMed Score 143.80
PubTator Score 33.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.800 4.3e-02
invasive ductal carcinoma -1.400 3.7e-04
medulloblastoma, large-cell -1.200 7.1e-03
oligodendroglioma 1.500 1.6e-03
ovarian cancer -1.200 8.9e-06
Pick disease -1.500 7.3e-05
progressive supranuclear palsy -1.400 1.8e-02
tuberculosis and treatment for 3 months 1.100 2.3e-06

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQI      1 - 70
LERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG     71 - 140
WSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRV    141 - 210
VKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSV    211 - 280
LLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTG    281 - 350
DKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS    351 - 420
LRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLG    421 - 490
QDL                                                                       491 - 493
//

Text Mined References (9)

PMID Year Title