Property Summary

NCBI Gene PubMed Count 9
PubMed Score 135.43
PubTator Score 33.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 1.500 1.6e-03
medulloblastoma, large-cell -1.200 7.1e-03
tuberculosis and treatment for 3 months 1.100 2.3e-06
Breast cancer -2.800 4.3e-02
Pick disease -1.500 7.3e-05
progressive supranuclear palsy -1.400 1.8e-02
invasive ductal carcinoma -1.400 3.7e-04
ovarian cancer -1.200 8.9e-06

Synonym

Accession Q9Y600 A8K0U4 Q4QQH9 Q9UNJ5 Q9Y601
Symbols CSD
PCAP

Gene

PANTHER Protein Class (2)

PDB

2JIS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (2)

PMID Text
26327310 taurine biosynthesis in vertebrates involves two structurally related PLP-dependent decarboxylases (cysteine sulfinic acid decarboxylase and glutamic acid decarboxylase like 1)
22718265 The presence of cysteine inhibited ADC, CSAD and GDC activity.

AA Sequence

MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQI      1 - 70
LERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG     71 - 140
WSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRV    141 - 210
VKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSV    211 - 280
LLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTG    281 - 350
DKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS    351 - 420
LRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLG    421 - 490
QDL                                                                       491 - 493
//

Text Mined References (9)

PMID Year Title
26327310 2015 Mammalian CSAD and GADL1 have distinct biochemical properties and patterns of brain expression.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22718265 2013 Mechanism of cysteine-dependent inactivation of aspartate/glutamate/cysteine sulfinic acid ?-decarboxylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997111 2002 Cloning of murine cysteine sulfinic acid decarboxylase and its mRNA expression in murine tissues.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.