| Tbio | Quinone oxidoreductase-like protein 1 |
This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| Down syndrome | 548 |
| Muscle Weakness | 92 |
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 6.0e-15 |
| medulloblastoma, large-cell | 6234 | 1.6e-04 |
| adult high grade glioma | 2148 | 3.3e-04 |
| osteosarcoma | 7933 | 1.1e-03 |
| glioblastoma | 5572 | 1.1e-03 |
| astrocytoma | 1493 | 3.6e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| FG syndrome | 17 | 5.057 | 2.5 |
| Exudative vitreoretinopathy | 15 | 4.06 | 2.0 |
| Opitz-GBBB syndrome | 19 | 3.385 | 1.7 |
| Congenital stationary night blindness | 28 | 3.35 | 1.7 |
| Intellectual disability | 573 | 3.233 | 1.6 |
| Coats disease | 13 | 3.16 | 1.6 |
| Congenital nystagmus | 26 | 3.006 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | 1.664 | 1.1e-03 |
| astrocytoma | -1.100 | 3.6e-02 |
| glioblastoma | -1.600 | 1.1e-03 |
| medulloblastoma, large-cell | -1.300 | 1.6e-04 |
| adult high grade glioma | -1.700 | 3.3e-04 |
| ovarian cancer | -2.200 | 6.0e-15 |
| PMID | Text | |
|---|---|---|
| 17497241 | Data show that human and yeast zeta-crystallins bind AU-rich elements in RNA. |
MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV 1 - 70 LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS 71 - 140 HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL 141 - 210 EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA 211 - 280 TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF 281 - 349 //
| PMID | Year | Title | |
|---|---|---|---|
| 25201988 | 2014 | Common genetic variants associated with cognitive performance identified using the proxy-phenotype method. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 17497241 | 2007 | Human and yeast zeta-crystallins bind AU-rich elements in RNA. | |
| 16780588 | 2006 | Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 10986039 | 2000 | Genomic sequence, splicing, and gene annotation. | |
| 10830953 | 2000 | The DNA sequence of human chromosome 21. | |
| 10191096 | 1999 | Identification of a zeta-crystallin (quinone reductase)-like 1 gene (CRYZL1) mapped to human chromosome 21q22.1. |
