Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAAQPVDEVPFYI      1 - 70
TASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG                                    71 - 109
//

Text Mined References (5)

PMID Year Title