Property Summary

NCBI Gene PubMed Count 35
PubMed Score 50.67
PubTator Score 26.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
nephrosclerosis -1.379 1.5e-02
urothelial carcinoma -1.400 1.8e-05
astrocytoma -3.400 1.1e-03
ependymoma -3.400 1.6e-03
oligodendroglioma -2.900 2.6e-22
cutaneous lupus erythematosus -1.500 8.0e-04
glioblastoma -3.900 1.3e-11
medulloblastoma -3.600 1.1e-06
non diabetic and post-ischemic heart fai... 1.200 9.3e-03
atypical teratoid / rhabdoid tumor -3.200 9.1e-10
medulloblastoma, large-cell -3.600 5.0e-07
primitive neuroectodermal tumor -2.800 2.5e-04
intraductal papillary-mucinous carcinoma... 1.700 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.300 3.3e-03
lung cancer -1.900 6.1e-05
sarcoidosis -1.100 2.2e-02
interstitial cystitis -1.600 3.8e-02
pediatric high grade glioma -3.100 6.9e-07
pilocytic astrocytoma -3.100 1.2e-06
subependymal giant cell astrocytoma -2.210 3.1e-02
severe Alzheimer's disease -1.423 2.5e-02
lung carcinoma 3.400 1.9e-53
Pick disease -1.700 1.9e-03
Down syndrome -1.100 3.1e-02

Gene RIF (13)

PMID Text
26173510 These findings confirm that, mechanistically, ketimine reductase/CRYM acts as a classical imine reductase and may explain the finding of bound pyruvate in the crystallized protein.
25931162 ketimine reductase is a key enzyme in the pipecolate pathway, which is the main lysine degradation pathway in the brain
23508717 The expression of mu-crystallin was regulated through the AP-1 site in the promoter.
21332720 The purified human mu-crystallin was confirmed to have ketimine reductase activity with a maximum specific activity similar to that of native ovine ketimine reductase
21332720 Its ketimine reductase activity is strongly inhibited by thyroid hormones.
21332720 Its enzyme function has been determined as a ketimine reductase in mammalian brain.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20018174 This is the first report linking hyperglycemia with thyroid hormone binding protein CRYM and suggests that the role of CRYM in diabetic complications should be further investigated.
19353593 CRYM is a novel androgen-regulated gene whose expression is elevated in prostate cancer but down-regulated in castration therapy-resistant tumors.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
17451686 up-regulation of mu-crystallin may play a specific and important role in pathogenesis of facioscapulohumeral muscular dystrophy
12471561 Identification of CRYM as a candidate responsible for nonsyndromic deafness, through cDNA microarray analysis of human cochlear and vestibular tissues

AA Sequence

MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAED      1 - 70
ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLC     71 - 140
ILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEP    141 - 210
ILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVK    211 - 280
PAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK                                        281 - 314
//

Text Mined References (39)

PMID Year Title
26173510 2015 Ketimine reductase/CRYM catalyzes reductive alkylamination of ?-keto acids, confirming its function as an imine reductase.
25931162 2015 Insights into Enzyme Catalysis and Thyroid Hormone Regulation of Cerebral Ketimine Reductase/?-Crystallin Under Physiological Conditions.
25057873 2014 Adipose tissue ?-crystallin is a thyroid hormone-binding protein associated with systemic insulin sensitivity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23508717 2013 Possible roles of the AP-1 site in the cytosolic T3 binding protein promoter and insights into its physiological significance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21418222 2011 Crystallin-gazing: unveiling enzymatic activity.
21332720 2011 Mammalian forebrain ketimine reductase identified as ?-crystallin; potential regulation by thyroid hormones.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20018174 2010 Hyperglycemia induces elevated expression of thyroid hormone binding protein in vivo in kidney and heart and in vitro in mesangial cells.
19353593 2009 Identification of mu-crystallin as an androgen-regulated gene in human prostate cancer.
19280551 2009 Spiking expression of mu-crystallin mRNA during treatment with methimazole in patients with graves' hyperthyroidism.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19007775 2009 Genetics of crystallins: cataract and beyond.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17692531 2007 mu-crystallin, a NADPH-dependent T(3)-binding protein in cytosol.
17451686 2007 Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy.
17264173 2007 micro-Crystallin as an intracellular 3,5,3'-triiodothyronine holder in vivo.
17242435 2007 Crystal structure of human micro-crystallin complexed with NADPH.
16740909 2006 CRYM mutations cause deafness through thyroid hormone binding properties in the fibrocytes of the cochlea.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12590647 2003 Cell-specific expression of NADPH-dependent cytosolic 3,5,3'-triiodo-L-thyronine-binding protein (p38CTBP).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471561 2003 Identification of CRYM as a candidate responsible for nonsyndromic deafness, through cDNA microarray analysis of human cochlear and vestibular tissues.
11897713 2002 Nicotinamide adenine dinucleotide phosphate-dependent cytosolic T(3) binding protein as a regulator for T(3)-mediated transactivation.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
9328354 1997 Purification, molecular cloning, and functional expression of the human nicodinamide-adenine dinucleotide phosphate-regulated thyroid hormone-binding protein.
9285773 1997 Two roles for mu-crystallin: a lens structural protein in diurnal marsupials and a possible enzyme in mammalian retinas.
8895318 1996 High affinity thyroid hormone-binding protein in human kidney: kinetic characterization and identification by photoaffinity labeling.
1478656 1992 Localization of the human gene for mu-crystallin to chromosome 16p.
1384048 1992 mu-crystallin is a mammalian homologue of Agrobacterium ornithine cyclodeaminase and is expressed in human retina.