Property Summary

NCBI Gene PubMed Count 27
PubMed Score 153.96
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Gene RIF (10)

AA Sequence

MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWM      1 - 70
GLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNY     71 - 140
RGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY                                       141 - 175
//

Text Mined References (28)

PMID Year Title