Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.00
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cataract 297 3.661 1.8

Gene RIF (3)

AA Sequence

MGKITFYEDRDFQGRCYNCISDCPNLRVYFSRCNSIRVDSGCWMLYERPNYQGHQYFLRRGKYPDYQHWM      1 - 70
GLSDSVQSCRIIPHTSSHKLRLYERDDYRGLMSELTDDCACVPELFRLPEIYSLHVLEGCWVLYEMPNYR     71 - 140
GRQYLLRPGDYRRYHDWGGADAKVGSLRRVTDLY                                        141 - 174
//

Text Mined References (14)

PMID Year Title