Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.15
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFE      1 - 70
SRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLW     71 - 140
AHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPS    141 - 210
S//

Text Mined References (17)

PMID Year Title