Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.15
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (3)

AA Sequence

MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFE      1 - 70
SRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLW     71 - 140
AHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPS    141 - 210
S//

Text Mined References (17)

PMID Year Title