Property Summary

NCBI Gene PubMed Count 52
PubMed Score 121.67
PubTator Score 119.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

AA Sequence

MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGE      1 - 70
QFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEK     71 - 140
VSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN         141 - 205
//

Text Mined References (53)

PMID Year Title