Property Summary

NCBI Gene PubMed Count 43
PubMed Score 77.21
PubTator Score 51.48

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (25)

AA Sequence

MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQ      1 - 70
GRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFR     71 - 140
PIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEP    141 - 210
GDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK                                211 - 252
//

Text Mined References (44)

PMID Year Title