Property Summary

NCBI Gene PubMed Count 286
PubMed Score 191.98
PubTator Score 203.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 4.394 2.2
Myopathy 185 3.78 1.9

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytoma 1.100 4.4e-08
Atopic dermatitis -1.300 4.6e-04
atypical teratoid / rhabdoid tumor -1.600 4.0e-02
Barrett's esophagus -1.200 3.4e-02
Breast cancer -3.600 2.4e-16
breast carcinoma -2.800 1.2e-05
colon cancer -3.800 3.1e-04
cystic fibrosis -6.364 1.7e-08
Down syndrome 1.400 1.1e-03
ductal carcinoma in situ -3.100 2.0e-03
Endometriosis -1.081 2.1e-02
esophageal adenocarcinoma -2.500 2.3e-02
fibroadenoma -1.800 3.7e-03
group 4 medulloblastoma -1.700 4.2e-03
intraductal papillary-mucinous adenoma (... -1.800 2.0e-05
intraductal papillary-mucinous carcinoma... -2.000 5.4e-06
intraductal papillary-mucinous neoplasm ... -2.100 3.4e-04
invasive ductal carcinoma -1.834 6.5e-04
lung adenocarcinoma -2.400 3.1e-21
lung cancer -1.500 6.3e-03
medulloblastoma, large-cell -2.600 4.4e-03
non-small cell lung carcinoma -1.600 1.3e-17
ovarian cancer -1.700 4.2e-06
pituitary cancer -2.600 6.9e-05
psoriasis -1.400 1.5e-06

PDB (18)

Gene RIF (232)

AA Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRL      1 - 70
EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD     71 - 140
GVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK                                       141 - 175
//

Text Mined References (292)

PMID Year Title