Property Summary

NCBI Gene PubMed Count 154
PubMed Score 658.36
PubTator Score 91.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (113)

PMID Text
26975472 alphaA-crystallin membrane insertion is oligomer-size dependent
26867756 The p.R21Q mutation of CRYAA is the most likely cause of paediatric cataract in this family.
26719333 Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf.
26700637 isomerization of Asp might disrupt the higher order polymeric state of alpha-crystallin, resulting in decreased solubility and function, ultimately contributing to lens protein impairment and cataract formation with aging
26657544 Similar to wild type alphaA- and alphaB-crystallins, the deamidated mutants showed strong interaction with betaA3-crystallin.
26459035 these results suggest that individuals carrying the alphaA-Crystallin R12C mutation are at an increased risk to develop early-onset cataract under condition of oxidative stress
26351848 In the lens epithelium of the high myopia-related cataract group and the age related cataract group, the mRNA and soluble protein expression of aA- and aB-crystallin were both decreased.
26116912 Since alpha-crystallins play an important role in preventing cataract in the eye lens and in the development of diverse diseases, understanding their mechanism and substrate spectra is of importance. [review]
26080000 Congenital cataract causing arginine mutations alters the structure and decreases the chaperone function of alpha-crystallin. These mutations also affect the lens morphology and phenotypes (review).
26004348 Identification of a novel mutation in CRYAA associated with congenital cataracts.
25729975 A novel disease-causing mutation, c.246_248delCGC (p.117delR), of the CRYAA gene has been identified in a Chinese family with autosomal-type perinuclear congenital cataracts.
25694240 The loss of interactions between alpha A-crystallin N-terminal mutants and alpha B-crystallin signifies quaternary structural alterations due to mutation in the arginine residues.
25663476 CpG islands hypermethylation of alphaA-crystallin gene may be involved in nuclear cataract formation after pars plana vitrectomy.
25574047 Knockout of alphaA-crystallin inhibited pathologic neovascularization through the VEGF and VEGFR2 signaling pathways both in vitro and in vivo.
25478825 A 19-residue fragment of human alpha-crystallin A not only exhibits chaperone-like activity toward gamma D-crystallin but also forms a stable complex with it.
25018622 N-terminal mutants of alphaA-crystallin are structurally and functionally more sensitive to gamma irradiation when compared to their non irradiated counterparts and wt.
24951543 Genetic variations of KCNAB1 and CRYAA are associated with age-related nuclear cataract.
24453475 One-hundred and twenty-seven of 17,225 human full-length proteins were identified that interact with CRYAA.
24275510 All alpha-crystallins displayed significant protection to oxidative stress induced cell death, while only the alphaB-crystallins reduced cell death induced by thermal stress.
24074001 This study identified a novel disease-causing mutation c.161 G > T (p.R54L) in CRYAA in a Chinese family with autosomal dominant nuclear cataracts.
23755258 Protein interaction motifs identified in mutant alpha A crystallin by subunit cross-linking and mass spectrometry.
23508955 The alphaA- and alphaB-crystallin peptides inhibited stress-induced aggregation of four client proteins, and the alphaA-acetyl peptide was more effective than the native peptide against three of the client proteins.
23441109 A CRYAA mutation is identified in family A and a CRYGC mutation in family B with congenital cataract
23410823 We show that proteases with the potential to generate alphaA-66-80 peptide are present in bovine and human lenses.
23288997 A novel disease-causing mutation c.161G>C (p.R54P) in the CRYAA gene has been identified in a Chinese family with autosomal dominant Y-suture cataracts.
23255486 the p.R21Q mutation in CRYAA responsible for the cataract phenotype observed in this family
22982407 Lysine acetylation improves anti-apoptotic function of CRYAB and CRYAA.
22970163 The present study was undertaken to determine the effect of alphaA-crystallin-derived mini-chaperone on the stability and chaperone activity of alphaAG98R-crystallin.
22889833 Data suggest that alphaA-crystallin (CRYAA) undergoes epigenetic repression in the lens epithelia in age-related nuclear cataract.
22655036 The perturbed conformation of human gamma-crystallin D, I90F mutant, was recognized and bound by both alpha-crystallin A and alpha-crystallin B chaperones.
22359280 The Phase II inflammation was responsible for vision-threatening opacity and was markedly suppressed by different means of inhibition of the HSPB4/TLR2/NF-kappaB axis.
22347476 interaction of the mutants of alphaA-crystallin with alphaB-crystallin was studied. The subunit exchange rates of R21W and R116C with alphaB-wt decreased drastically as compared to alphaA-wt interacting with alphaB-wt.
22347398 The decrease of both Deltamu and gamma at Tc, and a relative increase in solubility, reveal a significative decrease in the strenght of alpha-crystallin subunits interactions, which protects from supramolecolar condensation in hypertermic conditions
22272318 Data show that among the three small heat shock proteins, Hsp27, alphaA- and alphaB-crystallin, the R12A mutation improved the chaperone function of only alphaA-crystallin.
22216983 This study identified a novel cataract-microcornea phenotype caused by the recurrent mutation p.R116H in CRYAA, and suggested that this mutation site is not likely the consequence of a founder effect, but probably a result of a mutational hot spot.
22210387 Subunit exchange kinetics leading to HspB1-HspB5 or HspB4-HspB5 hetero-complex formation revealed that HspB5 exchanges more rapidly subunits with HspB1 than with HspB4.
22169612 A missense mutation in CRYAA is associated with congenital anterior polar cataract in a Chinese family.
22140512 Mutants of alphaA-crystallin form aggregates and aggresomes.
22120592 The chaperone function of the in vitro acetylated alphaA-crystallin was higher against three of the four different client proteins tested.
22085609 alpha-crystallin complexes containing F71L-alphaA subunits are less stable and have reduced chaperone-like activity
22065922 The present study identified a missense mutation (R116H) in the CRYAA gene that causes autosomal dominant congenital anterior polar cataracts in a Chinese family.
22052021 alphaA-crystallin was up-regulated in the cytoplasm of photoreceptors in the Sympathetic ophthalmia retina
22045060 quaternary structural parameters and chaperone function were investigated in alphaA-wt and in the mutants: R12C, R21L, R21W, R49C, R54C, R116C and R116H; although a specific change in the alphaA-crystallin behavior that is common to all the mutants was not evident, each mutant showed one or more perturbation as the end effect that leads to cataract
21866213 Novel mutations in the crystalline genes have been identified in Chinese families with congenital cataracts.
21686328 Mutations in GJA8 and CRYAA were identified in three Chinese families with cataract and microcornea.
21617844 alphaA-crystallin and AGE were highly expressed in human diabetic retina. alphaA-crystallin responded to AGE accumulation, which may contribute to the protection of photoreceptors against AGE-related retinal tissue injury.
21612679 The c.34C > T mutation in CRYAA caused the occurrence of congenital cataract with microcornea in this family.
21552534 crystallin-derived peptides such as alphaA-(66-80), generated in vivo, can induce age-related lens changes by disrupting the structure and organization of crystallins
21364639 Results show that alphaA-crystallin inhibits apoptosis by enhancing PI3K activity and inactivating phosphatase tensin homologue and that the antiapoptotic function is directly related to its chaperone activity.
21300147 role of the chaperone site in Cu2+ binding in native alphaA-crystallin was confirmed by the significant loss of chaperone activity by the peptide after Cu2+ binding
21245144 evidence for the first time that expression of deamidated alphaA-crystallin caused disruption of fiber cell structural integrity, protein aggregation, insolubilization, and mild cortical lens opacity.
21092858 Pax6 expression in dopaminergic neurons of the olfactory bulb controls the expression of crystallin alpha A which regulates the survival of these neurons.
21061147 Methylglyoxal modification destroys the folded structure and hydrophobic clefts in a-crystallin accelerating cataract formation of eye lens.
20813964 Elevated alpha crystallin is associated with highly infiltrative apoptosis-resistant glioblastoma.
20606865 Observational study of gene-disease association. (HuGE Navigator)
20465443 Mutation in CRYAA gene causing autosomal dominant nuclear cataracts. Some patients show nystagmus or small blepharophimosis. These results provide evidence that CRYAA is a pathogenic gene for congenital cataracts.
20434541 AlphaA-crystallin seems to negatively regulate pancreatic carcinogenesis.
20079887 the missense mutation R116H resulted in an altered size distribution, impaired packing of secondary structures and modified quaternary structure with great hydrophobic exposure. The mutant exhibited a substrate-dependent chaperone or anti-chaperone effect
19862354 unlike wild type alphaA-crystallin, G98R AlphaA-crystallin and its mixed oligomers with wild type protein are vulnerable to heavy metal ions.
19651604 The structures of recombinant alpha-crystallins were analyzed using biophysical methods.
19595763 This is the first report of an alphaA-F71L mutation being associated with ge-related cataract.
19595763 Observational study of gene-disease association. (HuGE Navigator)
19558454 Co-immunoprecipitation experiments rule out an interaction of alphaA(alphaB)-crystallins with PAR-1, PAR-3, and PAR-4, demonstrating that alphaA(alphaB)-crystallins are PAR-2-specific interaction proteins.
19503744 R12C mutation in CRYAA was responsible for a variable type of inherited cataract associated with microcornea in this Chinese family; expression of R12C CRYAA with altered chaperoning capability modified the heat-shock response of affected cells
19463898 Studies show that The major proteins in the lens--alpha, beta, and gamma-crystallins--are constantly subjected to age-related changes.
19401464 the motifs III and IV of betaA3-crystallin were interactive with alphaA-crystallin, and motifs II and III of betaA3-crystallin primarily interacted with alphaB-crystallin
19390652 Report a new nonsense mutation (Y56X) in CRYGD and a prev'ly reported missense mutation (R12C) in CRYAA associated with nuclear autosomal dominant congenital cataract in Brazilian families. A new polymorphism (S119S) in CRYGC was observed in one family.
19071118 These data suggest a mechanism whereby a transient disulfide bond occurs between alphaA- and betaB1-crystallin followed by a disulfide exchange with cysteine 49 of a neighboring alphaA-crystallin subunit.
19020808 These results suggest that the two cysteine residues, even though they could be modified, do not take part in the MGO-induced improvement in the chaperone function of human alpha A-crystallin
18949065 A serine-type betaA3-crystallin proteinase existed in an inactive state in the alpha-crystallin fraction and was activated by detergents.
18779867 the eleven C-terminal residues including Arg-163 and the C-terminal flexible arm of CRYAA significantly affect the interaction with target proteins
18754677 A maximum loss in chaperone activity of lens alpha A-crystallin occurs following deamidation of asparagine123, followed by deletion of the N-terminal domain (residues 1-63), but none occurred on the deletion of C-terminal extension (residues 140-173).
18700785 the decrease in the solubility of the alphaA-R49C mutant protein was due to an increase in its hydrophobicity and supra-aggregation of alphaA-crystallin that leads to cataract formation.
18692065 Results describe the selective copper binding, redox silencing, and cytoprotective effects of the small heat shock proteins alphaA- and alphaB-crystallin.
18639655 BB is the most susceptible to gamma-irradiation and that alpha B-crystallin forms a more stable aggregate than alpha A-crystallin under normal conditions.
18521724 This study was aimed to investigate the effect of AGE crosslinks on the chaperone activity of alpha-crystallin.
18477484 structures close to Asp58 and Asp151 residues in the protein affect the rate constant of Asp racemization and the size and chaperone function of alpha A-crystallin
18407550 Sequencing of CRYAA revealed a novel heterozygous G>A transition (c.346G>A) in exon 3 that cosegregated with the disease phenotype and results in a conservative substitution of Arg to His at codon 116
18344542 Findings support the hypothesis that positively charged guanidino group on arginine residues keeps the chaperone function of alphaA-crystallin in check and that methylglyoxal neutralizes this charge to restore and enhance chaperone function.
18343237 These results suggest that the changes in the structure and function of the alpha-crystallin complex and cytotoxicity are vital factors in the pathogenesis of congenital cataract linked to the P20S mutation in the alphaB-crystallin.
18302245 With the exception of iris coloboma, the clinical features (cataracts, microcornea and/or corneal opacity) in all six previously reported families with mutations in the CRYAA gene were found in this family
18199971 G98R mutation causes conformational changes that makes the complexes the mutant protein forms with certain substrates prone to precipitattion, suggesting an etiology of cataract in individuals with this mutation.
18095658 Bivalent zinc specifically interacts with alpha-crystallin with a dissociation constant in the submillimolar range.
18056999 this is the first knock-in mouse model for a crystallin mutation causing hereditary human cataract and establishes that alphaA-R49C promotes protein insolubility and cell death in vivo.
18004741 presence of measurable interactions between MIP26 and all crystallins, with the extent of interactions decreasing from alphaA- and alphaB-crystallin to betaB2- and gammaC-crystallin.
17973972 Presbyopia may be the result of a loss of alpha-crystallin coupled with progressive heat-induced denaturation of structural proteins in the lens during the first five decades of life.
17937925 R54C is the second reported recessive CRYAA mutation associated with congenital cataract and the first with described morphology. punctuate lenticular opacities in carriers and congenital total white cataract with microcornea in homozygotes.
17909943 The presence of an intact C-terminus is essential for the formation of fully integrated heteroaggregates with equal proportion of alphaA and alphaB subunits.
17900621 mixed oligomers of wild-type and G98R alphaA-crystallin exhibit properties dominated by those of the mutant protein in structural aspects, oligomeric size, urea-induced unfolding and, more importantly, the chaperone activity
17724170 Five novel mutations in CRYAA, CRYGD, and GJA8 genes were detected in congenital cataract in association with microcornea
17662998 characterization of the formation of amyloid fibrils by human alphaB-crystallin in detail, and also that of alphaA-crystallin and the disease-related mutant R120G alphaB-crystallin
17296897 This study indicates that an Arg116Cys mutation in the CRYAA gene could be associated with an unusual phenotype in affected individuals.
17258947 alpha A-crystallin is more stable to gamma irradiation than alpha B-crystallin
17149363 G98R mutation in alphaA-crystallin results in altered folding and becomes aggregation-prone leading to formation of large oligomers lacking chaperone function.
16760894 Proper orientation of residues contributing to RS-1 and RS-2 sites in alphaB-crystallin is important for homooligomerization and optimal subunit interaction with alphaA-crystallin.
16751613 results indicate only slight decreased efficiency and increased distance between two probes for the R116C alphaA and R120G alphaB mutations despite conformational changes
16735993 Mapping a locus for syndromal cataract (cataract-microcornea syndrome) on 21q22.3. (CRYAA)
16584192 Positive charges on R21, R49, and R103 are important determinants of chaperone function of alphaA-crystallin & suggest that chemical modification of arginine residues may play a role in protein aggregation during lens aging & cataract formation.
16531622 Mutations in alphaA-crystallin activate substrate binding
16453125 Based upon the unique finding of the mutation and the expression of CRYAA in the lens, this R21L mutation in the CRYAA is considered to be causative for the dominant cataract phenotype.
16012168 May be involved in protection of hepatocytes from the toxic effects of high concentrations of bile acids
15817465 isothermal titration calorimetric analysis of hydrophobicity and the chaperone-like function of alphaA- and alphaB-crystallin
15701626 the rate of subunit exchange is not the critical parameter in determining efficient chaperone behavior for alphaA-crystallin
15388868 Using a cross-linker, close proximity of C termini of alpha A and alpha B crystallins was demonstrated.
15382236 results suggest that the presence of the alpha-crystallin domain and hydrophobic clefts on the protein surface, which correlate poorly with oligomeric size, are important for chaperone function
15284238 both Asn residues (Asn-101 and Asn-123) are required for the structural integrity and chaperone function of alphaA-crystallin
15004872 accumulation and abnormal modification of alpha-crystallins might be implicated in the pathogenic mechanism of anterior polar cataracts.
14532291 the SRLFDQFFG sequence region contributes to the oligomer dynamics in addition to the higher order assembly and structural stability, and is one of the critical motifs in structure-function regulation of alpha A- and alpha B-crystallin
12501218 The regions of alpha A crystallin most affected by interaction with ATP are near putative substrate binding regions, as determined by hydrogen-deuterium exchange.
12369832 The positive charge of a basic amino acid, (such as arginine or lysine) must be preserved at position 116 for the structural and functional integrity of alpha A-crystallin.
12095619 suppression of dithiothreitol-induced aggregation of abrin by alpha A-crystallin
11756414 The R116C mutation in alpha A-crystallin diminishes its protective ability against stress-induced lens epithelial cell apoptosis
894324 Alpha A crystallin is a moonlighting protein that functions as a heat shock protein as well as a lens crystallin.

AA Sequence

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDK      1 - 70
FVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLT     71 - 140
FCGPKIQTGLDATHAERAIPVSREEKPTSAPSS                                         141 - 173
//

Text Mined References (160)

PMID Year Title
26975472 2016 Membrane insertion of ?A-crystallin is oligomer-size dependent.
26867756 2016 Recurrent mutation in the crystallin alpha A gene associated with inherited paediatric cataract.
26719333 2016 Regulation of c-Maf and ?A-Crystallin in Ocular Lens by Fibroblast Growth Factor Signaling.
26700637 2016 Isomerization of Asp residues plays an important role in ?A-crystallin dissociation.
26657544 2015 Interaction of ?A3-Crystallin with Deamidated Mutants of ?A- and ?B-Crystallins.
26459035 2015 The impact of Hydrogen peroxide on structure, stability and functional properties of Human R12C mutant ?A-crystallin: The imperative insights into pathomechanism of the associated congenital cataract incidence.
26351848 2015 UPR Activation and the Down-Regulation of ?-Crystallin in Human High Myopia-Related Cataract Lens Epithelium.
26116912 2016 Structure and function of ?-crystallins: Traversing from in vitro to in vivo.
26080000 2016 Differential role of arginine mutations on the structure and functions of ?-crystallin.
26004348 2015 Mutation analysis of two families with inherited congenital cataracts.
25729975 2015 A novel 3-base pair deletion of the CRYAA gene identified in a large Chinese pedigree featuring autosomal dominant congenital perinuclear cataract.
25694240 2015 Real-time heterogeneous protein-protein interaction between ?A-crystallin N-terminal mutants and ?B-crystallin using quartz crystal microbalance (QCM).
25663476 2015 ?A-crystallin gene CpG islands hypermethylation in nuclear cataract after pars plana vitrectomy.
25574047 2015 Knockout of ?A-crystallin inhibits ocular neovascularization.
25478825 2015 Molecular mechanism of the chaperone function of mini-?-crystallin, a 19-residue peptide of human ?-crystallin.
25416956 2014 A proteome-scale map of the human interactome network.
25018622 2014 Comparison of effect of gamma ray irradiation on wild-type and N-terminal mutants of ?A-crystallin.
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
24453475 2014 Identification of proteins that interact with alpha A-crystallin using a human proteome microarray.
24319337 2013 Molecular and structural analysis of genetic variations in congenital cataract.
24312600 2013 Epigenetic regulation of ?A-crystallin in high myopia-induced dark nuclear cataract.
24275510 2014 Alpha-crystallin-mediated protection of lens cells against heat and oxidative stress-induced cell death.
24074001 2013 A R54L mutation of CRYAA associated with autosomal dominant nuclear cataracts in a Chinese family.
23755258 2013 Identification of subunit-subunit interaction sites in ?A-WT crystallin and mutant ?A-G98R crystallin using isotope-labeled cross-linker and mass spectrometry.
23508955 2013 Chaperone peptides of ?-crystallin inhibit epithelial cell apoptosis, protein insolubilization, and opacification in experimental cataracts.
23508780 2013 Whole exome sequencing in dominant cataract identifies a new causative factor, CRYBA2, and a variety of novel alleles in known genes.
23441109 2013 Pathogenic mutations in two families with congenital cataract identified with whole-exome sequencing.
23410823 2013 Profiling of lens protease involved in generation of ?A-66-80 crystallin peptide using an internally quenched protease substrate.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23288997 2012 A novel mutation in CRYAA is associated with autosomal dominant suture cataracts in a Chinese family.
23255486 2013 Identification of a novel oligomerization disrupting mutation in CRY?A associated with congenital cataract in a South Australian family.
23188086 2012 Binding determinants of the small heat shock protein, ?B-crystallin: recognition of the 'IxI' motif.
22982407 2013 The combined effect of acetylation and glycation on the chaperone and anti-apoptotic functions of human ?-crystallin.
22970163 2012 ?A-Crystallin-derived mini-chaperone modulates stability and function of cataract causing ?AG98R-crystallin.
22890888 2012 Identification of histidine residues involved in Zn(2+) binding to ?A- and ?B-crystallin by chemical modification and MALDI TOF mass spectrometry.
22889833 2012 Down-regulation and CpG island hypermethylation of CRYAA in age-related nuclear cataract.
22655036 2012 Cataract-causing defect of a mutant ?-crystallin proceeds through an aggregation pathway which bypasses recognition by the ?-crystallin chaperone.
22359280 2012 Identification of the HSPB4/TLR2/NF-?B axis in macrophage as a therapeutic target for sterile inflammation of the cornea.
22347476 2012 Mutations in human ?A-crystallin/sHSP affect subunit exchange interaction with ?B-crystallin.
22347398 2012 The thermal structural transition of alpha-crystallin modulates subunit interactions and increases protein solubility.
22272318 2012 Hydroimidazolone modification of the conserved Arg12 in small heat shock proteins: studies on the structure and chaperone function using mutant mimics.
22216983 2012 Identification of the p. R116H mutation in a Chinese family with novel variable cataract phenotype: evidence for a mutational hot spot in ?A-crystallin gene.
22210387 2012 Structural and functional specificity of small heat shock protein HspB1 and HspB4, two cellular partners of HspB5: role of the in vitro hetero-complex formation in chaperone activity.
22169612 2011 [Gene mapping and mutation detection in a family with congenital anterior polar cataract].
22140512 2011 Congenital cataract causing mutants of ?A-crystallin/sHSP form aggregates and aggresomes degraded through ubiquitin-proteasome pathway.
22120592 2012 Acetylation of ?A-crystallin in the human lens: effects on structure and chaperone function.
22085609 2011 Temperature-dependent structural and functional properties of a mutant (F71L) ?A-crystallin: molecular basis for early onset of age-related cataract.
22065922 2011 Congenital anterior polar cataract associated with a missense mutation in the human alpha crystallin gene CRYAA.
22052021 2012 Expression of ?-crystallin in the retina of human sympathetic ophthalmia.
22045060 2012 Quaternary structural parameters of the congenital cataract causing mutants of ?A-crystallin.
21866213 2011 Mutation analysis of 12 genes in Chinese families with congenital cataracts.
21686328 2011 Mutational screening of six genes in Chinese patients with congenital cataract and microcornea.
21617844 2011 Increased expression of ?A-crystallin in human diabetic eye.
21612679 2011 [CRYAA gene mutation study in a family with autosomal dominant congenital cataract combined with microcornea].
21552534 2011 ?A-crystallin peptide SDRDKFVIFLDVKHF accumulating in aging lens impairs the function of ?-crystallin and induces lens protein aggregation.
21364639 2010 The anti-apoptotic function of human ?A-crystallin is directly related to its chaperone activity.
21300147 2011 Identification and characterization of a copper-binding site in ?A-crystallin.
21245144 2011 The common modification in alphaA-crystallin in the lens, N101D, is associated with increased opacity in a mouse model.
21092858 2010 The transcription factor Pax6 regulates survival of dopaminergic olfactory bulb neurons via crystallin ?A.
21061147 2010 Effect of methylglyoxal modification of human ?-crystallin on the structure, stability and chaperone function.
20836128 2010 Importance of eye lens ?-crystallin heteropolymer with 3:1 ?A to ?B ratio: stability, aggregation, and modifications.
20813964 2010 ?B-crystallin is elevated in highly infiltrative apoptosis-resistant glioblastoma cells.
20606865 2010 Association of G>A transition in exon-1 of alpha crystallin gene in age-related cataracts.
20465443 2010 Autosomal dominant congenital nuclear cataracts caused by a CRYAA gene mutation.
20434541 The small heat shock protein alphaA-crystallin is expressed in pancreas and acts as a negative regulator of carcinogenesis.
20079887 2010 Effects of congenital cataract mutation R116H on alphaA-crystallin structure, function and stability.
19862354 2009 Synergistic effects of metal ion and the pre-senile cataract-causing G98R alphaA-crystallin: self-aggregation propensities and chaperone activity.
19651604 2009 The eye lens chaperone alpha-crystallin forms defined globular assemblies.
19595763 2009 A novel mutation (F71L) in alphaA-crystallin with defective chaperone-like function associated with age-related cataract.
19558454 2009 Alpha A-crystallin and alpha B-crystallin, newly identified interaction proteins of protease-activated receptor-2, rescue astrocytes from C2-ceramide- and staurosporine-induced cell death.
19503744 2009 An alphaA-crystallin gene mutation, Arg12Cys, causing inherited cataract-microcornea exhibits an altered heat-shock response.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
19463898 2009 Lens aging: effects of crystallins.
19401464 2009 Identification of interaction sites between human betaA3- and alphaA/alphaB-crystallins by mammalian two-hybrid and fluorescence resonance energy transfer acceptor photobleaching methods.
19390652 2009 Mutation analysis of CRYAA, CRYGC, and CRYGD associated with autosomal dominant congenital cataract in Brazilian families.
19071118 2009 Disulfide cross-links in the interaction of a cataract-linked alphaA-crystallin mutant with betaB1-crystallin.
19020808 2009 Role of cysteine residues in the enhancement of chaperone function in methylglyoxal-modified human alpha A-crystallin.
18949065 2008 Isolation and characterization of betaA3-crystallin associated proteinase from alpha-crystallin fraction of human lenses.
18779867 2008 Interaction of C-terminal truncated human alphaA-crystallins with target proteins.
18754677 2008 Structural and functional roles of deamidation and/or truncation of N- or C-termini in human alpha A-crystallin.
18700785 2008 Mechanism of insolubilization by a single-point mutation in alphaA-crystallin linked with hereditary human cataracts.
18692065 2008 Selective Cu2+ binding, redox silencing, and cytoprotective effects of the small heat shock proteins alphaA- and alphaB-crystallin.
18639655 2008 Study of subunit interactions of alpha A- and alpha B-crystallins and the effects of gamma-irradiation on their interactions by surface plasmon resonance.
18587492 2008 Crystallin gene mutations in Indian families with inherited pediatric cataract.
18521724 2008 Reversal of chaperone activity loss of glycated alphaA-crystallin by a crosslink breaker.
18477484 2008 Differential rate constants of racemization of aspartyl and asparaginyl residues in human alpha A-crystallin mutants.
18407550 2008 A novel mutation in AlphaA-crystallin (CRYAA) caused autosomal dominant congenital cataract in a large Chinese family.
18344542 2008 Chemical modulation of the chaperone function of human alphaA-crystallin.
18343237 2008 Cataract mutation P20S of alphaB-crystallin impairs chaperone activity of alphaA-crystallin and induces apoptosis of human lens epithelial cells.
18302245 2008 Clinical variability of autosomal dominant cataract, microcornea and corneal opacity and novel mutation in the alpha A crystallin gene (CRYAA).
18199971 2007 Cataract-causing alphaAG98R mutant shows substrate-dependent chaperone activity.
18095658 2008 Zn2+ enhances the molecular chaperone function and stability of alpha-crystallin.
18056999 2008 Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death.
18004741 2008 Confocal fluorescence microscopy study of interaction between lens MIP26/AQP0 and crystallins in living cells.
17973972 2007 Presbyopia and heat: changes associated with aging of the human lens suggest a functional role for the small heat shock protein, alpha-crystallin, in maintaining lens flexibility.
17937925 2007 Recessive congenital total cataract with microcornea and heterozygote carrier signs caused by a novel missense CRYAA mutation (R54C).
17909943 2008 C-Terminal truncation affects subunit exchange of human alphaA-crystallin with alphaB-crystallin.
17900621 2007 Mixed oligomer formation between human alphaA-crystallin and its cataract-causing G98R mutant: structural, stability and functional differences.
17724170 2007 Genetic heterogeneity in microcornea-cataract: five novel mutations in CRYAA, CRYGD, and GJA8.
17662998 2007 Characterisation of amyloid fibril formation by small heat-shock chaperone proteins human alphaA-, alphaB- and R120G alphaB-crystallins.
17296897 2007 New phenotype associated with an Arg116Cys mutation in the CRYAA gene: nuclear cataract, iris coloboma, and microphthalmia.
17258947 2007 Differential susceptibility of alpha A- and alpha B-crystallin to gamma-ray irradiation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17149363 2006 The cataract-causing mutation G98R in human alphaA-crystallin leads to folding defects and loss of chaperone activity.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16760894 2006 The interaction between alphaA- and alphaB-crystallin is sequence-specific.
16751613 2006 Fluorescence resonance energy transfer study of subunit exchange in human lens crystallins and congenital cataract crystallin mutants.
16735993 2006 A novel fan-shaped cataract-microcornea syndrome caused by a mutation of CRYAA in an Indian family.
16584192 2006 Effect of site-directed mutagenesis of methylglyoxal-modifiable arginine residues on the structure and chaperone function of human alphaA-crystallin.
16531622 2006 Mechanism of a hereditary cataract phenotype. Mutations in alphaA-crystallin activate substrate binding.
16453125 2006 Congenital cataract and macular hypoplasia in humans associated with a de novo mutation in CRYAA and compound heterozygous mutations in P.
16303126 2006 Lenticular chaperones suppress the aggregation of the cataract-causing mutant T5P gamma C-crystallin.
16012168 2005 Alpha-crystallin is a target gene of the farnesoid X-activated receptor in human livers.
15817465 2005 Insights into hydrophobicity and the chaperone-like function of alphaA- and alphaB-crystallins: an isothermal titration calorimetric study.
15701626 2005 Subunit exchange of polydisperse proteins: mass spectrometry reveals consequences of alphaA-crystallin truncation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388868 2004 The reaction of alpha-crystallin with the cross-linker 3,3'-dithiobis(sulfosuccinimidyl propionate) demonstrates close proximity of the C termini of alphaA and alphaB in the native assembly.
15382236 2004 Relationship between chaperone activity and oligomeric size of recombinant human alphaA- and alphaB-crystallin: a tryptic digestion study.
15284238 2004 Deamidation affects structural and functional properties of human alphaA-crystallin and its oligomerization with alphaB-crystallin.
15004872 2004 Accumulation and aberrant modifications of alpha-crystallins in anterior polar cataracts.
14752512 2004 Human alphaA- and alphaB-crystallins bind to Bax and Bcl-X(S) to sequester their translocation during staurosporine-induced apoptosis.
14532291 2003 Role of the conserved SRLFDQFFG region of alpha-crystallin, a small heat shock protein. Effect on oligomeric size, subunit exchange, and chaperone-like activity.
14512969 2003 Cell death triggered by a novel mutation in the alphaA-crystallin gene underlies autosomal dominant cataract linked to chromosome 21q.
12601044 2003 Alteration of protein-protein interactions of congenital cataract crystallin mutants.
12501218 2002 Alpha-crystallin regions affected by adenosine 5'-triphosphate identified by hydrogen-deuterium exchange.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369933 2001 Chaperone-like activity of alpha-crystallin and other small heat shock proteins.
12369832 2002 A positive charge preservation at position 116 of alpha A-crystallin is critical for its structural and functional integrity.
12356833 2002 Enhanced C-terminal truncation of alphaA- and alphaB-crystallins in diabetic lenses.
12095619 2002 Suppression of DTT-induced aggregation of abrin by alphaA- and alphaB-crystallins: a model aggregation assay for alpha-crystallin chaperone activity in vitro.
12060738 2002 Shotgun identification of protein modifications from protein complexes and lens tissue.
11700327 2002 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay.
11672428 2001 Unfolding and refolding of a quinone oxidoreductase: alpha-crystallin, a molecular chaperone, assists its reactivation.
11377425 2001 Interaction of human recombinant alphaA- and alphaB-crystallins with early and late unfolding intermediates of citrate synthase on its thermal denaturation.
11123904 2000 Structural and functional changes in the alpha A-crystallin R116C mutant in hereditary cataracts.
11024455 2000 Self-complementary motifs (SCM) in alpha-crystallin small heat shock proteins.
11006246 2000 A nonsense mutation (W9X) in CRYAA causes autosomal recessive cataract in an inbred Jewish Persian family.
10930324 2000 The major in vivo modifications of the human water-insoluble lens crystallins are disulfide bonds, deamidation, methionine oxidation and backbone cleavage.
10830953 2000 The DNA sequence of human chromosome 21.
10217480 1999 Alpha-crystallin as a molecular chaperone.
9655350 1998 In vivo acetylation identified at lysine 70 of human lens alphaA-crystallin.
9618718 1998 Investigation of the 'fines' hypothesis of primary open-angle glaucoma: the possible role of alpha-crystallin.
9543632 1998 Quantitation of asparagine-101 deamidation from alpha-A crystallin during aging of the human lens.
9467006 1998 Autosomal dominant congenital cataract associated with a missense mutation in the human alpha crystallin gene CRYAA.
9346914 1997 The interaction of the molecular chaperone, alpha-crystallin, with molten globule states of bovine alpha-lactalbumin.
9068373 1996 Modifications of the water-insoluble human lens alpha-crystallins.
8999933 1997 Sequence analysis of betaA3, betaB3, and betaA4 crystallins completes the identification of the major proteins in young human lens.
8943244 1996 Cloning, expression, and chaperone-like activity of human alphaA-crystallin.
8910261 1996 Glycation mediated crosslinking between alpha-crystallin and MP26 in intact lens membranes.
8759518 1996 Differential phosphorylation of alpha-A crystallin in human lens of different age.
8587135 1995 A reassessment of mammalian alpha A-crystallin sequences using DNA sequencing: implications for anthropoid affinities of tarsier.
8175657 1994 Post-translational modifications of water-soluble human lens crystallins from young adults.
7835394 1994 A partial cDNA sequence corrects the human alpha A-crystallin primary structure.
3758227 1986 Isolation and partial characterization of the human alpha A-crystallin gene.
3610158 1987 Confirmation of assignment of the human alpha 1-crystallin gene (CRYA1) to chromosome 21 with regional localization to q22.3.
2918909 1989 A pseudo-exon in the functional human alpha A-crystallin gene.
1730617 1992 Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine.
1525182 1992 Site-specific glycation of lens crystallins by ascorbic acid.
894324 Peripheral nerve changes induced by local application of bee venom.
817940 1975 The amino acid sequence of the A chain of human alpha-crystallin.