Property Summary

NCBI Gene PubMed Count 75
PubMed Score 215.87
PubTator Score 83.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -1.600 3.2e-103
cutaneous lupus erythematosus -1.300 5.2e-04
posterior fossa group A ependymoma -1.400 7.7e-14
glioblastoma -1.900 1.2e-15
sonic hedgehog group medulloblastoma -1.800 2.1e-09
atypical teratoid / rhabdoid tumor -1.800 3.9e-11
medulloblastoma, large-cell -1.900 4.0e-07
primitive neuroectodermal tumor -1.400 8.6e-06
non-small cell lung cancer -1.361 3.5e-26
lung cancer -1.200 1.4e-03
adult high grade glioma -1.900 2.2e-08
pilocytic astrocytoma -1.800 4.1e-13
non primary Sjogren syndrome sicca 1.200 3.2e-02
subependymal giant cell astrocytoma -1.227 8.1e-03
lung adenocarcinoma -1.400 7.1e-10
inflammatory breast cancer -1.100 4.1e-03
spina bifida -1.106 4.0e-02
ductal carcinoma in situ -1.100 1.7e-03
invasive ductal carcinoma -1.400 2.8e-03

Protein-protein Interaction (8)

Gene RIF (53)

PMID Text
26966073 Given the distinct characteristics of the C-terminal tails of the CRY1 and CRY2 proteins, our study addresses a long-standing hypothesis that the ratio of these two CRY molecules affects the clock period.
26768731 Altered CRY1 and CRY2 expression patterns and the interplay with the genetic landscape in colon cancer cells may underlie phenotypic divergence.
26726810 data may point to CRY2 as a novel switch in hepatic fuel metabolism promoting triglyceride storage and, concomitantly, limiting glucose production
25855785 Data indicate that cryptochrome 2 (CRY2) knockdown leads to chemosensitivity of colorectal cancer cell lines.
25740058 These findings suggest that the core circadian gene CRY2 is associated with breast cancer progression and prognosis, and that knockdown of CRY2 causes the epigenetic dysregulation of genes involved in cancer-relevant pathways
25707907 these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.
25391456 CRY1 and CRY2 variants showed nominal association with the metabolic syndrome components, hypertension and triglyceride levels.
25365257 CRY2 and REV-ERB ALPHA as the clock genes upregulated in obesity during the 24 h period and that REV-ERB ALPHA is an important gene associated with MS.
24335056 Our data indicate that variants in the circadian-related genes CRY2 and MTNR1B may affect long-term changes in energy expenditure, and dietary fat intake may modify the genetic effects.
24099037 CRY2 genetic variants associate with the depressive episodes in a range of mood disorder; CRY2 is hypothesized to a key to the resetting of clocks throughout and play a leading role in the antidepressant effect of total sleep deprivation
23951166 Four CRY2 genetic variants (rs10838524, rs7121611, rs7945565, rs1401419) associated significantly with dysthymia (false discovery rate q<0.05).
23546644 Studies indicate that in the cytoplasm, PER3 protein heterodimerizes with PER1, PER2, CRY1, and CRY2 proteins and enters into the nucleus, resulting in repression of CLOCK-BMAL1-mediated transcription.
23323702 These data document for the first time that the expression of BMAL1, PER3, PPARD and CRY2 genes is altered in gestational diabetes compared to normal pregnant women. deranged expression of clock genes may play a pathogenic role in GDM.
23317246 Reduced cry2 expression is associated with glioma.
22538398 Genetic variants of CRY2 associate with seasonal affective disorder or winter depression.
21747906 the associations of GLIS3-rs7034200 and CRY2-rs11605924 with fasting glucose, beta cell function, and type 2 diabetes
21694704 Human CRY2 has the molecular capability to function as a light-sensitive magnetosensor.
21411511 Lean individuals exhibited significant (P < 0.05) temporal changes of core clock (PER1, PER2, PER3, CRY2, BMAL1, and DBP) and metabolic (REVERBalpha, RIP140, and PGC1alpha) genes.
20978934 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20856823 CRY2 gene variation was associated with bipolar disorder.
20856823 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20419449 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20334671 Data suggest a limited, but potentially important role for CRY2 in the regulation of DNA damage repair and the maintenance of genomic stability in breast cancer.
20233903 findings suggest a role for CRY2 in breast tumorigenesis
20233903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195522 Data suggest that CRY2 locus is associated with vulnerability for depression.
20195522 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
19934327 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19693801 Observational study of gene-disease association. (HuGE Navigator)
19470168 Observational study of gene-disease association. (HuGE Navigator)
19318546 Both genetic association and functional analyses suggest that the circadian gene CRY2 may play an important role in NHL development.
19318546 Observational study of gene-disease association. (HuGE Navigator)
18990770 Observational study of gene-disease association. (HuGE Navigator)
18444243 The expression level of CRY2 was decreased in hepatrocellular carcinoma.
18430226 The regulators of clock-controlled transcription PER2, CRY1 and CRY2 differ in their capacity to interact with each single component of the BMAL1-CLOCK heterodimer and, in the case of BMAL1, also in their interaction sites.
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17984998 Observational study of gene-disease association. (HuGE Navigator)
17440215 A clear circadian rhythm was shown for hPer1, hPer2, and hCry2 expression in CD34(+) cells and for hPer1 in the whole bone marrow, with maxima from early morning to midday.
16628007 the CLOCK(NPAS2)/BMAL1 complex is post-translationally regulated by cry1 and cry2
16528748 Observational study of gene-disease association. (HuGE Navigator)
15751956 The carboxyl-terminal domain of human cryptochrome 2 is intrinsically unstructured in solution, consistent with its presumed role as a signal transduction domain.
14750904 Transcripts of hCry2 underwent circadian oscillation. The expression profile of hCry2 was similar to that of hPer3.
12627958 CRY2 binds to DNA and in particular to single-stranded DNA with moderately high affinity and to DNA containing (6-4) photoproducts with higher affinity, but it has no DNA repair activity.

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR      1 - 70
WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG     71 - 140
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG    141 - 210
VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS    211 - 280
CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA    281 - 350
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS    351 - 420
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV    421 - 490
NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK    491 - 560
RKLEAAEEPPGEELSKRARVAELPTPELPSKDA                                         561 - 593
//

Text Mined References (81)

PMID Year Title
26966073 2016 The ratio of intracellular CRY proteins determines the clock period length.
26768731 2016 Deregulated expression of cryptochrome genes in human colorectal cancer.
26726810 2016 Glucose-Raising Polymorphisms in the Human Clock Gene Cryptochrome 2 (CRY2) Affect Hepatic Lipid Content.
26569474 2016 A magnetic protein biocompass.
25855785 2015 Circadian Clock Gene CRY2 Degradation Is Involved in Chemoresistance of Colorectal Cancer.
25740058 2015 The circadian gene CRY2 is associated with breast cancer aggressiveness possibly via epigenomic modifications.
25707907 2015 Season-dependent associations of circadian rhythm-regulating loci (CRY1, CRY2 and MTNR1B) and glucose homeostasis: the GLACIER Study.
25416956 2014 A proteome-scale map of the human interactome network.
25391456 2015 CRY1, CRY2 and PRKCDBP genetic variants in metabolic syndrome.
25365257 2014 Altered clock gene expression in obese visceral adipose tissue is associated with metabolic syndrome.
24418196 2014 The rhythmic expression of clock genes attenuated in human plaque-derived vascular smooth muscle cells.
24335056 2014 Variants in glucose- and circadian rhythm-related genes affect the response of energy expenditure to weight-loss diets: the POUNDS LOST Trial.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
24099037 2013 Black dog barks at brown fat.
23951166 2013 CRY2 genetic variants associate with dysthymia.
23916625 2014 Molecular architecture of the mammalian circadian clock.
23546644 2013 Analysis of the molecular pathophysiology of sleep disorders relevant to a disturbed biological clock.
23323702 2013 Circadian clock gene expression is impaired in gestational diabetes mellitus.
23317246 2012 Deregulated expression of cry1 and cry2 in human gliomas.
23303907 2013 Metabolism and the circadian clock converge.
22798407 2012 Identification of small molecule activators of cryptochrome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22538398 2012 Clock gene variants in mood and anxiety disorders.
21747906 2011 Variants in GLIS3 and CRY2 are associated with type 2 diabetes and impaired fasting glucose in Chinese Hans.
21694704 2011 Human cryptochrome exhibits light-dependent magnetosensitivity.
21411511 2011 Rhythmic diurnal gene expression in human adipose tissue from individuals who are lean, overweight, and type 2 diabetic.
20978934 2011 The role of polymorphisms in circadian pathway genes in breast tumorigenesis.
20856823 2010 CRY2 is associated with rapid cycling in bipolar disorder patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20334671 2010 Phenotypic effects of the circadian gene Cryptochrome 2 on cancer-related pathways.
20233903 2010 The core circadian gene Cryptochrome 2 influences breast cancer risk, possibly by mediating hormone signaling.
20195522 2010 CRY2 is associated with depression.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19934327 2009 Testing the circadian gene hypothesis in prostate cancer: a population-based case-control study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19318546 2009 Clock-cancer connection in non-Hodgkin's lymphoma: a genetic association study and pathway analysis of the circadian gene cryptochrome 2.
18990770 2008 Correlation between circadian gene variants and serum levels of sex steroids and insulin-like growth factor-I.
18444243 2008 Disturbance of circadian gene expression in hepatocellular carcinoma.
18430226 2008 Interaction of circadian clock proteins PER2 and CRY with BMAL1 and CLOCK.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984998 2008 Variants in circadian genes and prostate cancer risk: a population-based study in China.
17463251 2007 SCFFbxl3 controls the oscillation of the circadian clock by directing the degradation of cryptochrome proteins.
17440215 2007 Circadian variations in clock gene expression of human bone marrow CD34+ cells.
16790549 2006 Posttranslational regulation of the mammalian circadian clock by cryptochrome and protein phosphatase 5.
16628007 2006 Post-translational regulation of circadian transcriptional CLOCK(NPAS2)/BMAL1 complex by CRYPTOCHROMES.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16528748 2006 Suggestive evidence for association of the circadian genes PERIOD3 and ARNTL with bipolar disorder.
15798197 2005 Coupling of human circadian and cell cycles by the timeless protein.
15751956 2005 Role of structural plasticity in signal transduction by the cryptochrome blue-light photoreceptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147242 2004 Expression of the gene for Dec2, a basic helix-loop-helix transcription factor, is regulated by a molecular clock system.
14750904 2004 Phosphorylation of clock protein PER1 regulates its circadian degradation in normal human fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701732 2004 Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.
14672706 2004 A novel autofeedback loop of Dec1 transcription involved in circadian rhythm regulation.
14507900 2003 Expression of the blue-light receptor cryptochrome in the human retina.
12782655 2003 Loss of circadian rhythmicity in aging mPer1-/-mCry2-/- mutant mice.
12627958 2003 Purification and properties of human blue-light photoreceptor cryptochrome 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397359 2002 Dec1 and Dec2 are regulators of the mammalian molecular clock.
11889036 2002 Nucleocytoplasmic shuttling and mCRY-dependent inhibition of ubiquitylation of the mPER2 clock protein.
10531061 1999 Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.
10428031 1999 mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop.
10217146 1999 Mammalian Cry1 and Cry2 are essential for maintenance of circadian rhythms.
9801304 1998 Characterization of photolyase/blue-light receptor homologs in mouse and human cells.
9753616 1998 Molecular cloning of a second human stanniocalcin homologue (STC2).
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9383998 1997 Human blue-light photoreceptor hCRY2 specifically interacts with protein serine/threonine phosphatase 5 and modulates its activity.
8909283 1996 Putative human blue-light photoreceptors hCRY1 and hCRY2 are flavoproteins.