Property Summary

NCBI Gene PubMed Count 70
PubMed Score 375.99
PubTator Score 127.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Myeloid Leukemia, Chronic 22
Disease Target Count P-value
osteosarcoma 7933 2.2e-05
psoriasis 6685 8.6e-05
ovarian cancer 8491 1.4e-03
active Crohn's disease 918 3.5e-02
Disease Target Count Z-score Confidence
Bipolar Disorder 266 3.379 1.7
Obesity 616 3.316 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.700 8.6e-05
osteosarcoma 1.400 2.2e-05
active Crohn's disease 1.180 3.5e-02
ovarian cancer -1.400 1.4e-03

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (43)

PMID Text
26966073 Given the distinct characteristics of the C-terminal tails of the CRY1 and CRY2 proteins, our study addresses a long-standing hypothesis that the ratio of these two CRY molecules affects the clock period.
26768731 Altered CRY1 and CRY2 expression patterns and the interplay with the genetic landscape in colon cancer cells may underlie phenotypic divergence.
26319354 Collectively, these data show that KPNB1 is required for timely nuclear import of PER/CRY in the negative feedback regulation of the circadian clock.
26247999 possible circadian rhythm in full-term placental expression
26218278 Overexpression of CRY1 protects against the development of atherosclerosis via the TLR/NFkappaB pathway
26168277 In men undergoing acute total sleep deprivation, there was increased methylation in the promoter of CRY1 in adipose tissue compared with controls. Also decreased gene expression in skeletal muscle.
25707907 these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.
25391456 CRY1 and CRY2 variants showed nominal association with the metabolic syndrome components, hypertension and triglyceride levels.
25344870 SNPs in CRY1 were significantly associated with overall survival in Chinese hepatocellular carcinoma patients.
24581835 findings show the polymorphisms of Cry1 rs2287161 and Tef rs738499 are associated to major depressive disorder in the Chinese population
24548145 Study reveals an interaction between a CRY1 variant and carbohydrate intake for glucose metabolism.
24449901 Casein kinase 1 primarily regulates the accumulating phase of the PER-CRY repressive complex by controlling the nuclear import rate.
24158435 data suggest a new role for the C-terminal tail of CRY1 in which phosphorylation rhythmically regulates CRY1 stability and contributes to the proper circadian period length
23626715 Cry1 likely plays important roles in colorectal cancer development and progression.
23584858 Data suggest that clock genes Per1, Cry1, Clock, and Bmal1 and their protein products may be directly involved in the daytime-dependent regulation and adaptation of hormone synthesis.
23546644 Studies indicate that in the cytoplasm, PER3 protein heterodimerizes with PER1, PER2, CRY1, and CRY2 proteins and enters into the nucleus, resulting in repression of CLOCK-BMAL1-mediated transcription.
23317246 Reduced cry1 expression is associated with glioma.
23242607 Loss of Cry1 expression is associated with skin tumors.
23133559 type II protein arginine methyltransferase 5 has a role in the regulation of Circadian Per1 and CRY1 genes
22692217 the CRY1-PHR domain(313-426), not the divergent C-terminal domain, is critical for clock function.
22669941 USP2a potentially mediates circadian disruption by suppressing the CRY1 degradation during inflammation.
22538398 Genetic variants of CRY1 associate with depressive disorder.
22470559 The methylation pattern of the CRY1 promoter proved to have high prognostic impact in CLL where aberrant promoter methylation predicted a favourable outcome.
22427812 Human cryptochrome-1 confers light independent biological activity in transgenic Drosophila correlated with flavin radical stability.
22081238 Clock genes expression is sex dependent in human adipose tissue from morbidly obese subjects and correlates to a decreased in metabolic syndrome-related traits.
21846818 Five SNPs were validated as being significantly associated with prostate cancer mortality, one each in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes.
20978934 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20560679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20222832 There was no circadian rhythm of bmal1(brain and muscle ARNT-like 1) and cry1(cryptochrome 1) in PBMC of preterm neonates
20174623 Observational study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
19934327 Observational study of gene-disease association. (HuGE Navigator)
19693801 Observational study of gene-disease association. (HuGE Navigator)
19500131 differential expression and prognostic significance of the circadian genes CRY1 and PER2 in chronic lymphocytic leukemia
19181792 Cryptochrome-1 was a valuable predictor of disease progression in early-stage chronic lymphocytic leukemia
18430226 The regulators of clock-controlled transcription PER2, CRY1 and CRY2 differ in their capacity to interact with each single component of the BMAL1-CLOCK heterodimer and, in the case of BMAL1, also in their interaction sites.
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18195715 Observational study of gene-disease association. (HuGE Navigator)
17376600 Cry1 may be a candidate gene of schizophrenia. The proposition may have new clues on the development of genetic study on complex diseases
16628007 the CLOCK(NPAS2)/BMAL1 complex is post-translationally regulated by cry1 and cry2
15722957 Linkage disequilibrium analyses using single SNPs and haplotypes showed no association to bipolar disease.

AA Sequence

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLN      1 - 70
SRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIE     71 - 140
LNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVW    141 - 210
PGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNS    211 - 280
SPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE    281 - 350
GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR    351 - 420
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQ    421 - 490
LSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTG    491 - 560
LSGGKRPSQEEDTQSIGPKVQRQSTN                                                561 - 586
//

Text Mined References (75)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26966073 2016 The ratio of intracellular CRY proteins determines the clock period length.
26768731 2016 Deregulated expression of cryptochrome genes in human colorectal cancer.
26319354 2015 KPNB1 mediates PER/CRY nuclear translocation and circadian clock function.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
26218278 2015 Overexpression of CRY1 protects against the development of atherosclerosis via the TLR/NF-?B pathway.
26168277 2015 Acute Sleep Loss Induces Tissue-Specific Epigenetic and Transcriptional Alterations to Circadian Clock Genes in Men.
25707907 2015 Season-dependent associations of circadian rhythm-regulating loci (CRY1, CRY2 and MTNR1B) and glucose homeostasis: the GLACIER Study.
25391456 2015 CRY1, CRY2 and PRKCDBP genetic variants in metabolic syndrome.
25344870 2014 Functional polymorphisms of circadian negative feedback regulation genes are associated with clinical outcome in hepatocellular carcinoma patients receiving radical resection.
24581835 2014 Cry1 and Tef gene polymorphisms are associated with major depressive disorder in the Chinese population.
24548145 2014 CRY1 circadian gene variant interacts with carbohydrate intake for insulin resistance in two independent populations: Mediterranean and North American.
24449901 2014 Spatiotemporal separation of PER and CRY posttranslational regulation in the mammalian circadian clock.
24158435 2013 Phosphorylation of the cryptochrome 1 C-terminal tail regulates circadian period length.
23916625 2014 Molecular architecture of the mammalian circadian clock.
23626715 2013 Cryptochrome 1 overexpression correlates with tumor progression and poor prognosis in patients with colorectal cancer.
23584858 2013 Clock gene expression in the human pituitary gland.
23546644 2013 Analysis of the molecular pathophysiology of sleep disorders relevant to a disturbed biological clock.
23317246 2012 Deregulated expression of cry1 and cry2 in human gliomas.
23303907 2013 Metabolism and the circadian clock converge.
23242607 2013 Altered expression patterns of clock gene mRNAs and clock proteins in human skin tumors.
23133559 2012 Role of type II protein arginine methyltransferase 5 in the regulation of Circadian Per1 gene.
22798407 2012 Identification of small molecule activators of cryptochrome.
22692217 2012 Identification of a novel cryptochrome differentiating domain required for feedback repression in circadian clock function.
22669941 2012 USP2a protein deubiquitinates and stabilizes the circadian protein CRY1 in response to inflammatory signals.
22538398 2012 Clock gene variants in mood and anxiety disorders.
22470559 2012 Epigenetic silencing of the circadian clock gene CRY1 is associated with an indolent clinical course in chronic lymphocytic leukemia.
22427812 2012 Human cryptochrome-1 confers light independent biological activity in transgenic Drosophila correlated with flavin radical stability.
22170608 2011 Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.
22081238 2012 Sexual dimorphism in clock genes expression in human adipose tissue.
21846818 2011 Genetic variants in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes are prognostic markers of prostate cancer-specific mortality.
21690409 2011 Regulation of apoptosis by the circadian clock through NF-kappaB signaling.
21680841 2011 A molecular mechanism for circadian clock negative feedback.
21628572 2011 Circadian clock disruption improves the efficacy of chemotherapy through p73-mediated apoptosis.
21613214 2011 Biochemical analysis of the canonical model for the mammalian circadian clock.
20978934 2011 The role of polymorphisms in circadian pathway genes in breast tumorigenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20852621 2010 Cryptochrome mediates circadian regulation of cAMP signaling and hepatic gluconeogenesis.
20560679 2010 Response to methadone maintenance treatment is associated with the MYOCD and GRM6 genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20222832 2010 The circadian rhythm of expression of Bmal1 and Cry1 in peripheral blood mononuclear cells of preterm neonates.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19934327 2009 Testing the circadian gene hypothesis in prostate cancer: a population-based case-control study.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19500131 2009 Combined PER2 and CRY1 expression predicts outcome in chronic lymphocytic leukemia.
19181792 2009 Cryptochrome-1 expression: a new prognostic marker in B-cell chronic lymphocytic leukemia.
18430226 2008 Interaction of circadian clock proteins PER2 and CRY with BMAL1 and CLOCK.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
18195715 2008 Genotype patterns that contribute to increased risk for or protection from developing heroin addiction.
17852344 2008 Identification of coding polymorphisms in human circadian rhythm genes PER1, PER2, PER3, CLOCK, ARNTL, CRY1, CRY2 and TIMELESS in a multi-ethnic screening panel.
17463251 2007 SCFFbxl3 controls the oscillation of the circadian clock by directing the degradation of cryptochrome proteins.
17376600 2007 Cryptochrome1 maybe a candidate gene of schizophrenia.
16790549 2006 Posttranslational regulation of the mammalian circadian clock by cryptochrome and protein phosphatase 5.
16628007 2006 Post-translational regulation of circadian transcriptional CLOCK(NPAS2)/BMAL1 complex by CRYPTOCHROMES.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15722957 2005 Examination of the clock gene Cryptochrome 1 in bipolar disorder: mutational analysis and absence of evidence for linkage or association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147242 2004 Expression of the gene for Dec2, a basic helix-loop-helix transcription factor, is regulated by a molecular clock system.
15123698 2004 Regulation of the mammalian circadian clock by cryptochrome.
14672706 2004 A novel autofeedback loop of Dec1 transcription involved in circadian rhythm regulation.
14507900 2003 Expression of the blue-light receptor cryptochrome in the human retina.
12846824 2003 Novel ATP-binding and autophosphorylation activity associated with Arabidopsis and human cryptochrome-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397359 2002 Dec1 and Dec2 are regulators of the mammalian molecular clock.
11875063 2002 The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon.
11533252 2001 Nuclear entry mechanism of rat PER2 (rPER2): role of rPER2 in nuclear localization of CRY protein.
10531061 1999 Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.
10428031 1999 mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop.
10217146 1999 Mammalian Cry1 and Cry2 are essential for maintenance of circadian rhythms.
9801304 1998 Characterization of photolyase/blue-light receptor homologs in mouse and human cells.
9383998 1997 Human blue-light photoreceptor hCRY2 specifically interacts with protein serine/threonine phosphatase 5 and modulates its activity.
8921389 1996 Cloning, tissue expression, and mapping of a human photolyase homolog with similarity to plant blue-light receptors.
8909283 1996 Putative human blue-light photoreceptors hCRY1 and hCRY2 are flavoproteins.
8600518 1996 Similarity among the Drosophila (6-4)photolyase, a human photolyase homolog, and the DNA photolyase-blue-light photoreceptor family.