Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.09
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.211 2.3e-03
chronic lymphosyte leukemia -1.100 6.3e-09
astrocytoma 1.500 1.8e-02
group 4 medulloblastoma 1.200 1.2e-04
primary pancreatic ductal adenocarcinoma 1.170 1.3e-02
lung cancer -1.700 6.8e-04
ovarian cancer -2.000 2.5e-08
pancreatic cancer 1.400 6.5e-03

Protein-protein Interaction (1)

Gene RIF (12)

PMID Text
24264430 The CRTC3 polymorphism rs3862434 is associated with the plasma level of total cholesterol, and rs11635252 is associated with the risks of overweight and hypertriglyceridemia in a Chinese Han population.
24121173 Metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands did not harbor CRTC1-MAML2 and CRTC3-MAML2 fusion transcripts, respectively, or MAML2 gene rearrangement.
21668476 mucoepidermoid carcinoma of the salivary glands positive for CRTC1-MAML2 or CRTC3-MAML2 fusion formed a favourable tumour subset that was distinct from fusion-negative cases
21536665 CRTC3 plays a selective role in mitochondrial biogenesis in response to rotenone
21164481 As a common human CRTC3 variant with increased transcriptional activity is associated with adiposity in two distinct Mexican-American cohorts, results suggest that adipocyte CRTC3 may play a role in the development of obesity in humans
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19749740 Mucoepidermoid carcinomas possessing CRTC3-MAML2 fusion may be associated with favorable clinicopathological features and patients may be younger than those with CRTC1-MAML2 fusion or those with no detectable gene fusion.
18187620 Knockdown of CREB regulated transcription coactivator 3 (CRTC3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18050304 study reports for the first time a CRTC3-MAML2 fusion gene in a mucoepidermoid carcinoma, as determined by RT-PCR and sequencing.
17644518 BCL3 functions as a repressor of HTLV-1 LTR-mediated transcription through interactions with TORC3
16980408 These results strongly suggest that TORCs play a key role in linking these external signals to the transcriptional program of adaptive mitochondrial biogenesis by activating PGC-1alpha gene transcription.
15466468 transducer of regulated cyclic AMP-response element-binding protein 3 (TORC3), a co-activator of CREB, is involved in Tax-induced transcriptional activation from the HTLV-I LTR

AA Sequence

MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLR      1 - 70
SSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQ     71 - 140
PPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPG    141 - 210
PLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNL    211 - 280
HYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHP    281 - 350
QTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT    351 - 420
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQG    421 - 490
SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKD    491 - 560
LNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL               561 - 619
//

Text Mined References (38)

PMID Year Title
24264430 2014 CRTC3 polymorphisms were associated with the plasma level of total cholesterol and the risks of overweight and hypertriglyceridemia in a Chinese Han population.
24121173 2013 CRTC1-MAML2 and CRTC3-MAML2 fusions were not detected in metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23033494 2012 Phosphorylation of CRTC3 by the salt-inducible kinases controls the interconversion of classically activated and regulatory macrophages.
21668476 2011 Impact of CRTC1/3-MAML2 fusions on histological classification and prognosis of mucoepidermoid carcinoma.
21536665 2011 Role of cAMP-responsive element-binding protein (CREB)-regulated transcription coactivator 3 (CRTC3) in the initiation of mitochondrial biogenesis and stress response in liver cells.
21164481 2010 CRTC3 links catecholamine signalling to energy balance.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19749740 2009 Clinicopathological significance of the CRTC3-MAML2 fusion transcript in mucoepidermoid carcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18050304 2008 A new type of MAML2 fusion in mucoepidermoid carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17644518 2007 BCL3 acts as a negative regulator of transcription from the human T-cell leukemia virus type 1 long terminal repeat through interactions with TORC3.
17210223 2007 Dephosphorylation of TORC initiates expression of the StAR gene.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16980408 2006 Transducer of regulated CREB-binding proteins (TORCs) induce PGC-1alpha transcription and mitochondrial biogenesis in muscle cells.
16817901 2006 Silencing the constitutive active transcription factor CREB by the LKB1-SIK signaling cascade.
16809310 2006 TORC1 and TORC2 coactivators are required for tax activation of the human T-cell leukemia virus type 1 long terminal repeats.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15589160 2004 Activation of cAMP response element-mediated gene expression by regulated nuclear transport of TORC proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466468 2004 Enhanced activation of tax-dependent transcription of human T-cell leukemia virus type I (HTLV-I) long terminal repeat by TORC3.
15454081 2004 The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536081 2003 TORCs: transducers of regulated CREB activity.
14506290 2003 Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.