Property Summary

NCBI Gene PubMed Count 60
PubMed Score 31.58
PubTator Score 74.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute myeloid leukemia 785 1.8e-02
Disease Target Count Z-score Confidence
Hyperglycemia 120 3.052 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.100 1.8e-02

Protein-protein Interaction (6)

Gene RIF (43)

PMID Text
26652733 CRTC2 strongly enhances GR-induced transcriptional activity of glucocorticoid-responsive genes.
26438156 critical pathophysiologic event in the evolution of HER2-amplified cancers is the loss of the input signals that normally drive TORC2 signaling, repositioning it under Akt dependency, and fundamentally altering the role of HER3
26432405 In neuroblastoma, transcription of HIF2A is strongly dependent on mTORC2.
26004186 Our results establish a role for CRTC2 as a lymphoma tumor suppressor gene
25256670 the high expression of CRTC2 and PROM1 may play an important role in the occurrence and hereditary, and also advance the potential pathways that integrate genetic variants in the development of NSCLC.
24529027 These results clearly indicate that non-phosphorylated CRTC2 strongly enhances hepatitis b virus biosynthesis through inducing PGC1alpha expression.
24484648 The data from the current study demonstrated novel PROM1 and CRTC2 mutations, which could promote lung cancer development.
23671120 CRTC2 enhances CREB phosphorylation through an association with the protein arginine methyltransferase 5 (PRMT5).
23584792 Phosphorylation of CRTC2 at its AMPK target site, Ser 171, dictated its subcellular localization, and the activation of aromatase PII in preadipocytes.
23459592 we found that overexpressed RIOK2 formed a complex with RIOK1, mTor, and mTor-complex-2(TORC2) components, and that overexpressed RIOK2 upregulated Akt signaling and promoted tumorigenesis
23362262 TGFbeta-stimulated Smad 3 acts as a key node to instill a feedback loop between deptor down-regulation and TORC1/2 activation in driving mesangial cell hypertrophy
23213254 Mechanism of CREB recognition and coactivation by the CREB-regulated transcriptional coactivator CRTC2
22504275 discoveries reveal a homeostasis mechanism in which TORC2 responds to plasma membrane stress to mediate compensatory changes in cellular lipid synthesis and hence modulates the composition of the plasma membrane
22473959 mTORC2 is crucial for Notch signaling to regulate Akt and NF-kappaB.
22457331 Results suggest that a network structure connects mTORC2 to its upstream cues.
22457328 Studies indicate that understanding mTOR network circuitry will provide insight into its deregulation in diabetes, cancer, and cardiovascular disease, but modeling in silico to elucidate how insulin activates mTORC2 remains poorly defined.
22173835 during Epac1-induced activation of mTORC1 and mTORC2, Epac1 may have an additional function as a "scaffold" protein
22145100 mTORC2 signaling promotes GBM growth and survival and activates NF-kappaB.
22084251 multiple-site acetylation of Rictor signals for increased activation of mTORC2, providing a critical link between nutrient-sensitive deacetylases and mTORC2 signaling to Akt
22053105 Data show that mammalian target of rapamycin complex 1 (mTORC1) and 2 (mTORC2) are up-regulated in neoplastic and developing immature mast cells compared with their terminally differentiated counterparts.
22045983 Studies form the basis for further clinical testing of mammalian target of rapamycin (mTOR) complexes TORC1/2 inhibitors in multiple myeloma.
21804606 Our findings provide new mechanistic insights into the role of mTORC2 in BCR-ABL(+) cells and indicate that regulation by GILZ may influence TKI sensitivity.
21757730 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel
21415389 reconstituted high-density lipoprotein inhibits senescence onset in circulating angiogenic cells through mTOR complex 2 pathway activation
21339740 Selective activation of Akt1 through mTORC2 and P-Rex1 regulates cancer cell migration, invasion and metastasis.
21326806 The activation with overexpression of components of the mTORC2-PLD1 pathway in ULMS and to a lesser degree in STUMP provides insight into their tumorigenic mechanisms.
21321111 mTOR complex 2 targets Akt for proteasomal degradation via phosphorylation at the hydrophobic motif
21170086 mTORC2-addicted cells require mitochondrial functions that may be novel drug targets in human cancer.
21145500 propose that the mTORC2-dependent regulation of MyoII occurs through a cAMP/RhoA-signaling axis, independently of actin reorganization during neutrophil chemotaxis
20693566 The lipogenic effects of GIP in the presence of insulin are therefore at least partially mediated by upregulation of adipocyte LPL gene transcription through a pathway involving PI3-K/PKB/AMPK-dependent CREB/TORC2 activation.
20675384 the association of Pin1 with CRTC2 to decrease the nuclear CBP.CRTC.CREB complex.
20501647 Rictor phosphorylation takes place in mammalian target of rapamycin (mTORC)2-deficient cells; this modification may play a role in regulating not only mTORC2 but also the mTORC2-independent function of rictor.
20101207 Tax binds the cyclin D1 promoter-proximal cyclic AMP response element (CRE) in the presence of phosphorylated CREB (pCREB) in vitro, and together the Tax-pCREB complex recruits the cellular co-activator p300 to the promoter.
19509226 The regulation of aromatase by CRTC2, in response to the altered hormonal milieu associated with menopause and obesity, provides a critical link between obesity and breast cancer.
19164291 TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.
18626018 identify Ser-275 of TORC2 as a 14-3-3 binding site that is phosphorylated under low glucose conditions and which becomes dephosphorylated by calcineurin in response to glucose influx
18187620 Knockdown of CREB regulated transcription coactivator 2 (CRTC2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17950019 genetic variants of LKB1-AMPK-TORC2 pathway components may exert a weak influence on the occurrence of type 2 diabetes in Japanese
17950019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17548807 TORC2 regulates germinal center repression of the TCL1 oncoprotein to promote B cell development and inhibit transformation.
17476304 latent cytoplasmic coactivator TORC2 mediates target gene activation in response to cAMP signaling by associating with CBP/p300 and increasing its recruitment to a subset of CREB target genes
16980408 These results strongly suggest that TORCs play a key role in linking these external signals to the transcriptional program of adaptive mitochondrial biogenesis by activating PGC-1alpha gene transcription.
16809310 Thus, both TORC1/2 and p300 families of coactivators are essential for optimal activation of HTLV-1 transcription by Tax.

AA Sequence

MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGS      1 - 70
LPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPE     71 - 140
SSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMD    141 - 210
PKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTN    211 - 280
LHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNP    281 - 350
NLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST    351 - 420
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSS    421 - 490
PSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLE    491 - 560
QFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKE    561 - 630
IAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ           631 - 693
//

Text Mined References (76)

PMID Year Title
26652733 2016 CRTC2 Is a Coactivator of GR and Couples GR and CREB in the Regulation of Hepatic Gluconeogenesis.
26438156 2015 A TORC2-Akt Feed-Forward Topology Underlies HER3 Resiliency in HER2-Amplified Cancers.
26432405 2015 PI3K-mTORC2 but not PI3K-mTORC1 regulates transcription of HIF2A/EPAS1 and vascularization in neuroblastoma.
26004186 2015 The CREB Coactivator CRTC2 Is a Lymphoma Tumor Suppressor that Preserves Genome Integrity through Transcription of DNA Mismatch Repair Genes.
25256670 2014 CRTC2 and PROM1 expression in non-small cell lung cancer: analysis by Western blot and immunohistochemistry.
24529027 2014 CRTC2 enhances HBV transcription and replication by inducing PGC1? expression.
24484648 2014 Identification and validation of PROM1 and CRTC2 mutations in lung cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23671120 2013 PRMT5 modulates the metabolic response to fasting signals.
23584792 2013 CREB-regulated transcription co-activator family stimulates promoter II-driven aromatase expression in preadipocytes.
23459592 2013 A kinome-wide RNAi screen in Drosophila Glia reveals that the RIO kinases mediate cell proliferation and survival through TORC2-Akt signaling in glioblastoma.
23362262 2013 Transforming growth factor ? integrates Smad 3 to mechanistic target of rapamycin complexes to arrest deptor abundance for glomerular mesangial cell hypertrophy.
23213254 2012 Mechanism of CREB recognition and coactivation by the CREB-regulated transcriptional coactivator CRTC2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22504275 2012 Plasma membrane stress induces relocalization of Slm proteins and activation of TORC2 to promote sphingolipid synthesis.
22473959 2012 Vital roles of mTOR complex 2 in Notch-driven thymocyte differentiation and leukemia.
22457331 2012 A dynamic network model of mTOR signaling reveals TSC-independent mTORC2 regulation.
22457328 2012 Deconvolution of mTORC2 "in Silico".
22173835 2012 Upregulation of mTORC2 activation by the selective agonist of EPAC, 8-CPT-2Me-cAMP, in prostate cancer cells: assembly of a multiprotein signaling complex.
22145100 2011 Oncogenic EGFR signaling activates an mTORC2-NF-?B pathway that promotes chemotherapy resistance.
22084251 2012 Multiple site acetylation of Rictor stimulates mammalian target of rapamycin complex 2 (mTORC2)-dependent phosphorylation of Akt protein.
22053105 2011 mTORC1 and mTORC2 differentially regulate homeostasis of neoplastic and non-neoplastic human mast cells.
22045983 2011 Defining the role of TORC1/2 in multiple myeloma.
21804606 2012 GILZ inhibits the mTORC2/AKT pathway in BCR-ABL(+) cells.
21757730 2011 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel.
21415389 2011 mTOR complex 2 activation by reconstituted high-density lipoprotein prevents senescence in circulating angiogenic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21339740 2011 Selective activation of Akt1 by mammalian target of rapamycin complex 2 regulates cancer cell migration, invasion, and metastasis.
21326806 2010 Constitutive activation with overexpression of the mTORC2-phospholipase D1 pathway in uterine leiomyosarcoma and STUMP: morphoproteomic analysis with therapeutic implications.
21321111 2011 mTOR complex 2 targets Akt for proteasomal degradation via phosphorylation at the hydrophobic motif.
21269460 2011 Initial characterization of the human central proteome.
21170086 2011 Genome-wide shRNA screen reveals increased mitochondrial dependence upon mTORC2 addiction.
21145500 2010 mTORC2 regulates neutrophil chemotaxis in a cAMP- and RhoA-dependent fashion.
20864035 2010 AID-induced genotoxic stress promotes B cell differentiation in the germinal center via ATM and LKB1 signaling.
20693566 2010 GIP increases human adipocyte LPL expression through CREB and TORC2-mediated trans-activation of the LPL gene.
20675384 2010 Pin1 associates with and induces translocation of CRTC2 to the cytosol, thereby suppressing cAMP-responsive element transcriptional activity.
20541704 2010 GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis.
20504934 2010 Phorbol ester-induced human cytomegalovirus major immediate-early (MIE) enhancer activation through PKC-delta, CREB, and NF-kappaB desilences MIE gene expression in quiescently infected human pluripotent NTera2 cells.
20501647 2010 Rictor phosphorylation on the Thr-1135 site does not require mammalian target of rapamycin complex 2.
20300828 2010 Metformin inhibits aromatase expression in human breast adipose stromal cells via stimulation of AMP-activated protein kinase.
20101207 2010 The HTLV-1 tax protein cooperates with phosphorylated CREB, TORC2 and p300 to activate CRE-dependent cyclin D1 transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19564345 2009 The induction of IL-10 by zymosan in dendritic cells depends on CREB activation by the coactivators CREB-binding protein and TORC2 and autocrine PGE2.
19509226 2009 Subcellular localization of cyclic AMP-responsive element binding protein-regulated transcription coactivator 2 provides a link between obesity and breast cancer in postmenopausal women.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19372545 2009 AMP-activated protein kinase promotes human prostate cancer cell growth and survival.
19369332 2009 Breaking human cytomegalovirus major immediate-early gene silence by vasoactive intestinal peptide stimulation of the protein kinase A-CREB-TORC2 signaling cascade in human pluripotent embryonal NTera2 cells.
19164291 2009 TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18626018 2008 Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17950019 2008 Single nucleotide polymorphisms in genes encoding LKB1 (STK11), TORC2 (CRTC2) and AMPK alpha2-subunit (PRKAA2) and risk of type 2 diabetes.
17548807 2007 TORC2 regulates germinal center repression of the TCL1 oncoprotein to promote B cell development and inhibit transformation.
17476304 2007 Cooperative interactions between CBP and TORC2 confer selectivity to CREB target gene expression.
17210223 2007 Dephosphorylation of TORC initiates expression of the StAR gene.
17043309 2006 Identification of Sin1 as an essential TORC2 component required for complex formation and kinase activity.
16980408 2006 Transducer of regulated CREB-binding proteins (TORCs) induce PGC-1alpha transcription and mitochondrial biogenesis in muscle cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16817901 2006 Silencing the constitutive active transcription factor CREB by the LKB1-SIK signaling cascade.
16809310 2006 TORC1 and TORC2 coactivators are required for tax activation of the human T-cell leukemia virus type 1 long terminal repeats.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
15589160 2004 Activation of cAMP response element-mediated gene expression by regulated nuclear transport of TORC proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454081 2004 The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536081 2003 TORCs: transducers of regulated CREB activity.
14506290 2003 Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.