Property Summary

NCBI Gene PubMed Count 65
PubMed Score 55.18
PubTator Score 153.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.127 1.2e-04
glioblastoma -1.300 6.5e-10
primitive neuroectodermal tumor -1.100 5.2e-04
pediatric high grade glioma -1.100 8.3e-06
group 3 medulloblastoma -1.200 4.0e-03
pilocytic astrocytoma -1.200 2.7e-06
subependymal giant cell astrocytoma -1.003 3.5e-02

 IMPC Phenotype (1)

Gene RIF (46)

PMID Text
26796488 Detection of the CRTC1/MAML2 fusion transcript provides useful information for MEC diagnosis but is not associated with differences in survival outcomes.
26503699 A specific CRTC1-MAMl2-induced transcriptional program was identified in mucoepidermoid carcinoma cells.
25465874 CRTC1 activation is a key event that drives the LKB1-null mRNA signature in lung cancer. We also identified a positive feedback LKB1/CRTC1 signaling loop for COX-2/PGE2 regulation.
25300488 This study showed that CREB-regulated transcriptional coactivator 1 (CRTC1) is required for HBV transcription and replication.
25083993 describe fundamental metabolic requirements of senescent primary human CD8+ T cells and demonstrate that p38 MAPK blockade reverses senescence via an mTOR-independent pathway
25071166 Malignant mucoepidermoid salivary gland tumors can arise from a recurrent t (11, 19)(q21;p13.1) translocation that generates an unusual chimeric CRTC1/MAML2 oncoprotein.
24771140 Translocation t(11;19)(q14-21;p12-13) in patients with Salivary mucoepidermoid carcinoma was reported , which results in fusion between exons 1 and 2 of CRTC1 on chromosome 19p13.
24468654 Lacrimal and salivary gland PAs and Ca-ex-PAs have similar genomic profiles and frequently overexpress the PLAG1 oncoprotein. Copy number gains involving 9p23-p22.3 (NFIB) and 22q12-qter (PDGFB) may be of importance for disease progression.
24121173 Metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands did not harbor CRTC1-MAML2 and CRTC3-MAML2 fusion transcripts, respectively, or MAML2 gene rearrangement.
23975434 aberrantly activated AREG-EGFR signaling is required for CRTC1-MAML2-positive MEC cell growth and survival, suggesting that EGFR-targeted therapies will benefit patients with advanced, unresectable CRTC1-MAML2-positive MEC.
23925723 findings suggest that CRTC1 contributes to the genetics of human obesity in psychiatric patients and the general population.
23699513 The data of this study raise the prospect that CRTC1 plays a role in fundamental aspects of SCN clock timing and entrainment.
23362262 TGFbeta-stimulated Smad 3 acts as a key node to instill a feedback loop between deptor down-regulation and TORC1/2 activation in driving mesangial cell hypertrophy
23074285 CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
22805177 These observations indicate that brain malformations in TSC are likely a consequence of increased TORC1 activation during embryonic brain development.
22749528 We demonstrate that glutamine in combination with leucine activates mammalian TORC1 (mTORC1) by enhancing glutaminolysis and alpha-ketoglutarate production.
22627671 Inhibition of TORC1 retards, and to some extent reverses, phenotypic indicators of cellular senescence.
22457329 Studies indicate that phospholipase D (PLD) as a mediator of nutrients to mTORC1.
22236576 The results of this study suggested that CRTC1 dysfunction caused by Abeta accumulation underlies changes in gene expression required for hippocampal-dependent memory in AD transgenic mice.
21798997 clear-cell renal cell carcinoma become refractory to REDD1-induced mTORC1 inhibition and shed light into the development of clear-cell renal cell carcinoma
21706049 de-regulated LKB1-CRTC signaling might represent a crucial mechanism for esophageal cancer progression.
21668476 mucoepidermoid carcinoma of the salivary glands positive for CRTC1-MAML2 or CRTC3-MAML2 fusion formed a favourable tumour subset that was distinct from fusion-negative cases
21074686 The t(11;19) translocation and its CRTC1/MAML1 fusion transcript have been identified in mucoepidermoid carcinomas at different sites and are believed to be associated with the development of a subset of these tumors.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625861 We report an example of intraosseous mucoepidermoid carcinoma with positive TORC1/MAML2 gene fusion transcript and discuss the clinical implications.
20588178 MECT1/MAML2 translocation status may be important prognostically in salivary mucoepidermoid carcinomas, but it does not seem to override traditional clinicopathologic parameters.
20010869 Data show that somatic loss of LKB1 is associated with underphosphorylation of endogenous Crtc1, enhanced Crtc1 nuclear localization.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19531414 CRTC1-MAML2 fusion was associated with favorable clinicopathologic tumor features and was useful in predicting the overall survival of patients with salivary gland mucoepidermoid carcinoma
19521953 Mucoepidermoid carcinomas are often characterized by the fusion gene CRTC1-MAML2. The mean expression level of an embryonic stem cell marker, HMGA2 was studied and found to be higher in fusion negative than in positive tumors.
19438452 Mucoepidermoid carcinoma (MEC) of the skin harbours CRTC1 rearrangements, a molecular finding that reflects morphological similarities between glandular and cutaneous MEC.
19269006 MAML2 and MECT1 fusion product can be detected by fluorescence in situ hybridization and reverse transcriptase polymerase chain reaction analysis performed on low- and high-grade primary bronchopulmonary mucoepidermoid carcinoma
19164581 demonstrate that CRTC1-Maml2 oncoprotein, which causes mucoepidermoid carcinomas, binds and activates both c-Jun and c-Fos.
18784253 The activation of TORC1 through MEKK1-mediated phosphorylation, is reported.
18717645 Stimulation by lithium of the interaction between CREB and TORC1 is reported.
18206539 The presence of the t(11;19)(q21;p13) rearrangement favors a diagnosis of mucoepidermoid carcinoma.
18181164 CRTC1/MAML2 translocation and fusion transcript is asscociated with Warthin's tumor and mucoepidermoid carcinoma
17565599 the basic leucine zipper domain has a role in the regulation of transcriptional activity of CREB with TORC and salt inducible kinase [review]
17437281 CRTC1/MAML2 transcript may be detected in both low and high grade mucoepidermoid carcinoma (MEC), that fusion negative tumors may define a subset of biologically aggressive MEC's tumors
17334997 The present and previous observations indicate that the CRTC1-MAML2 fusion is etiologically linked to benign and low-grade malignant tumors originating from diverse exocrine glands rather than being linked to a separate tumor entity.
16980408 These results strongly suggest that TORCs play a key role in linking these external signals to the transcriptional program of adaptive mitochondrial biogenesis by activating PGC-1alpha gene transcription.
16818685 The MECT1-MAML2 fusion transcript may be specific to mucoepidermoid carcinoma and associated with a distinct mucoepidermoid carcinoma subset that exhibits favorable clinicopathologic features and an indolent clinical course.
16809310 Thus, both TORC1/2 and p300 families of coactivators are essential for optimal activation of HTLV-1 transcription by Tax.
16652146 mutant Mect1-Maml2 expression plasmid carried silent nucleotide changes within the RNAi target sequence and observed that co-transfection of this mutant, but not wild-type Mect1-Maml2, could partially rescue RNAi growth inhibition in the MEC tumor line
14720503 cloning of a novel fusion gene in mucoepidermoid carcinomas & benign Warthin's tumors; the fusion, which results from a translocation, creates a chimeric gene in which exon 1 of a novel gene designated WAMTP1 is linked to exons 2-5 of MAML2 [WAMPT1]
12539049 cloning and functional analyses of the t(11;19) fusion oncogene: t(11;19)(q21;p13) translocation in mucoepidermoid carcinoma creates a novel fusion product that disrupts a Notch signaling pathway.

AA Sequence

MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ      1 - 70
IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP     71 - 140
PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG    141 - 210
SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN    211 - 280
LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQL    281 - 350
PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS    351 - 420
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE    421 - 490
QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN    491 - 560
IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR    561 - 630
MDRL                                                                      631 - 634
//

Text Mined References (71)

PMID Year Title
26796488 2016 Role of CRTC1/MAML2 Translocation in the Prognosis and Clinical Outcomes of Mucoepidermoid Carcinoma.
26503699 2015 Gene expression profiling analysis of CRTC1-MAML2 fusion oncogene-induced transcriptional program in human mucoepidermoid carcinoma cells.
25465874 2015 Role of LKB1-CRTC1 on glycosylated COX-2 and response to COX-2 inhibition in lung cancer.
25300488 2014 Requirement of CRTC1 coactivator for hepatitis B virus transcription.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25083993 2014 p38 signaling inhibits mTORC1-independent autophagy in senescent human CD8? T cells.
25071166 2014 CRTC1/MAML2 gain-of-function interactions with MYC create a gene signature predictive of cancers with CREB-MYC involvement.
25057126 2014 Meta-analysis identifies loci affecting levels of the potential osteoarthritis biomarkers sCOMP and uCTX-II with genome wide significance.
24771140 2015 Salivary mucoepidermoid carcinoma revisited.
24468654 2014 Lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma: genomic profiles, gene fusions, and clinical characteristics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
24121173 2013 CRTC1-MAML2 and CRTC3-MAML2 fusions were not detected in metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands.
23975434 2014 Aberrantly activated AREG-EGFR signaling is required for the growth and survival of CRTC1-MAML2 fusion-positive mucoepidermoid carcinoma cells.
23925723 2013 Influence of CRTC1 polymorphisms on body mass index and fat mass in psychiatric patients and the general adult population.
23699513 2013 Clock and light regulation of the CREB coactivator CRTC1 in the suprachiasmatic circadian clock.
23362262 2013 Transforming growth factor ? integrates Smad 3 to mechanistic target of rapamycin complexes to arrest deptor abundance for glomerular mesangial cell hypertrophy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23074285 2012 The CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
22805177 2013 Fetal brain lesions in tuberous sclerosis complex: TORC1 activation and inflammation.
22749528 2012 Glutaminolysis activates Rag-mTORC1 signaling.
22627671 2012 Attenuation of TORC1 signaling delays replicative and oncogenic RAS-induced senescence.
22457329 2012 Phospholipase D and mTORC1: nutrients are what bring them together.
22236576 2012 CREB-regulated transcription coactivator 1-dependent transcription in Alzheimer's disease mice.
21798997 2011 Interplay between pVHL and mTORC1 pathways in clear-cell renal cell carcinoma.
21706049 2012 Altered LKB1/CREB-regulated transcription co-activator (CRTC) signaling axis promotes esophageal cancer cell migration and invasion.
21668476 2011 Impact of CRTC1/3-MAML2 fusions on histological classification and prognosis of mucoepidermoid carcinoma.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
21074686 2010 CRTC1/MAML2 fusion transcript in central mucoepidermoid carcinoma of mandible--diagnostic and histogenetic implications.
20936779 2010 A human MAP kinase interactome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625861 2010 Central mucoepidermoid carcinoma, a case report with molecular analysis of the TORC1/MAML2 gene fusion.
20588178 2010 A reappraisal of the MECT1/MAML2 translocation in salivary mucoepidermoid carcinomas.
20010869 2010 Enhanced activity of the CREB co-activator Crtc1 in LKB1 null lung cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19531414 2009 Prognostic significance of p27Kip1, Ki-67, and CRTC1-MAML2 fusion transcript in mucoepidermoid carcinoma: a molecular and clinicopathologic study of 101 cases.
19521953 2009 A link between the expression of the stem cell marker HMGA2, grading, and the fusion CRTC1-MAML2 in mucoepidermoid carcinoma.
19438452 2009 CRTC1 rearrangements in the absence of t(11;19) in primary cutaneous mucoepidermoid carcinoma.
19269006 2009 Mammalian mastermind like 2 11q21 gene rearrangement in bronchopulmonary mucoepidermoid carcinoma.
19164581 2009 The coactivator CRTC1 promotes cell proliferation and transformation via AP-1.
18784253 2008 Activation of TORC1 transcriptional coactivator through MEKK1-induced phosphorylation.
18717645 2009 Stimulation by lithium of the interaction between the transcription factor CREB and its co-activator TORC.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18206539 2008 A closer look at Warthin tumors and the t(11;19).
18181164 2008 CRTC1/MAML2 fusion transcript in Warthin's tumor and mucoepidermoid carcinoma: evidence for a common genetic association.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17565599 2007 TORC-SIK cascade regulates CREB activity through the basic leucine zipper domain.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17437281 2007 CRTC1/MAML2 fusion transcript in high grade mucoepidermoid carcinomas of salivary and thyroid glands and Warthin's tumors: implications for histogenesis and biologic behavior.
17334997 2007 Frequent fusion of the CRTC1 and MAML2 genes in clear cell variants of cutaneous hidradenomas.
17210223 2007 Dephosphorylation of TORC initiates expression of the StAR gene.
16980408 2006 Transducer of regulated CREB-binding proteins (TORCs) induce PGC-1alpha transcription and mitochondrial biogenesis in muscle cells.
16818685 2006 MECT1-MAML2 fusion transcript defines a favorable subset of mucoepidermoid carcinoma.
16817901 2006 Silencing the constitutive active transcription factor CREB by the LKB1-SIK signaling cascade.
16809310 2006 TORC1 and TORC2 coactivators are required for tax activation of the human T-cell leukemia virus type 1 long terminal repeats.
16652146 2006 Sustained expression of Mect1-Maml2 is essential for tumor cell growth in salivary gland cancers carrying the t(11;19) translocation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15729701 2005 Clear cell hidradenoma of the skin-a third tumor type with a t(11;19)--associated TORC1-MAML2 gene fusion.
15589160 2004 Activation of cAMP response element-mediated gene expression by regulated nuclear transport of TORC proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14720503 2004 Altered Notch signaling resulting from expression of a WAMTP1-MAML2 gene fusion in mucoepidermoid carcinomas and benign Warthin's tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536081 2003 TORCs: transducers of regulated CREB activity.
14506290 2003 Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells.
12539049 2003 t(11;19)(q21;p13) translocation in mucoepidermoid carcinoma creates a novel fusion product that disrupts a Notch signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.