Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.49
PubTator Score 16.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.100 1.4e-03
cutaneous lupus erythematosus 2.500 2.0e-03
osteosarcoma -2.873 3.4e-05
ependymoma -1.800 1.5e-04
glioblastoma -1.400 1.1e-02
atypical teratoid/rhabdoid tumor -1.800 2.0e-02
medulloblastoma -1.700 4.1e-02
non-small cell lung cancer -1.768 5.9e-19
lung cancer -1.900 2.7e-03
interstitial cystitis 1.600 9.2e-03
primary Sjogren syndrome 2.200 5.1e-05
subependymal giant cell astrocytoma -5.341 3.1e-03

Gene RIF (10)

PMID Text
26694968 These results reveal that CRTAM is critical to instruct the differentiation of CD4(+)CTL through the induction of Eomes and CTL-related gene.
25910959 CRTAM is negatively regulated by ZEB1 in T cells.
23871486 The cell adhesion molecule Necl-2 competitively binds the immune receptor CRTAM.
23827383 Case-control studies reveal malignant mesothelioma risk associated with variants in the SDK1, CRTAM and RASGRF2 genes.
23530148 The expression of CRTAM in activated Vgamma9Vdelta2 T cells is quickly downregulated following interaction with Necl-2 on tumor cells.
22051697 Three common variants in the class I MHC-restricted T cell-associated molecule gene were identified that were associated with an increased rate of asthma exacerbations based on the presence of a low circulating vitamin D level.
20556794 Results show that CRTAM is a molecule involved in epithelial cell adhesion.
19695707 CRTAM expression is driven by the JNK-AP-1 signaling pathway.
15811952 NK cells and T8 cells recognize Necl-2 through CRTAM, expressed only on activated cells. CRTAM-Necl-2 interactions promote cytotoxicity of NK cells and IFN-gamma secretion of T8 cells as well as NK cell-mediated rejection of tumors expressing Necl-2
15781451 Necl2/CRTAM molecular pair could regulate a large panel of cell/cell interactions both within and outside of the immune system

AA Sequence

MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSK      1 - 70
YQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLM     71 - 140
CSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVA    141 - 210
PFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLG    211 - 280
LARKKSGILLLTLVSFLIFILFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQ    281 - 350
SSHPMRCMNYITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV                               351 - 393
//

Text Mined References (16)

PMID Year Title
26694968 2016 CRTAM determines the CD4+ cytotoxic T lymphocyte lineage.
25910959 2015 CRTAM is negatively regulated by ZEB1 in T cells.
23871486 2013 Competition of cell adhesion and immune recognition: insights into the interaction between CRTAM and nectin-like 2.
23827383 2013 A genome-wide association study for malignant mesothelioma risk.
23530148 2013 CRTAM receptor engagement by Necl-2 on tumor cells triggers cell death of activated V?9V?2 T cells.
22051697 2012 Genome-wide association study reveals class I MHC-restricted T cell-associated molecule gene (CRTAM) variants interact with vitamin D levels to affect asthma exacerbations.
20556794 2010 CRTAM: A molecule involved in epithelial cell adhesion.
19695707 2009 Characterization of CRTAM gene promoter: AP-1 transcription factor control its expression in human T CD8 lymphocytes.
18329370 2008 Regulation of a late phase of T cell polarity and effector functions by Crtam.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16300832 2006 Human class-I restricted T cell associated molecule is highly expressed in the cerebellum and is a marker for activated NKT and CD8+ T lymphocytes.
15811952 2005 The tumor suppressor TSLC1/NECL-2 triggers NK-cell and CD8+ T-cell responses through the cell-surface receptor CRTAM.
15781451 2005 Nectin-like protein 2 defines a subset of T-cell zone dendritic cells and is a ligand for class-I-restricted T-cell-associated molecule.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10811014 2000 A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM).