Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.32
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 5.3e-03
oligodendroglioma 1.100 8.4e-03
glioblastoma -2.600 1.2e-05
ependymoma -2.500 1.2e-13
group 3 medulloblastoma -2.500 1.3e-03
atypical teratoid / rhabdoid tumor -3.400 2.7e-12
medulloblastoma, large-cell -2.500 2.8e-04
primitive neuroectodermal tumor -2.700 2.3e-03
non-small cell lung cancer -1.768 7.3e-21
lung cancer -4.100 3.7e-07
interstitial cystitis -3.400 4.4e-04
lung adenocarcinoma -3.900 2.3e-16
adult high grade glioma -2.100 3.2e-04
pilocytic astrocytoma -1.700 3.4e-04
lung carcinoma -1.800 3.8e-13
ovarian cancer 1.400 9.0e-05

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17602227 in bone fracture patients, 12 proteins were related to bone/cartilage metabolism, including: TGF-beta induced protein IG-H(3), cartilage acidic protein 1, procollagen C proteinase enhancer protein and TGF-beta receptor III.
17074475 CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFE      1 - 70
IVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFS     71 - 140
GVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIE    141 - 210
MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAA    211 - 280
ASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVIT    281 - 350
ADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL    351 - 420
ILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPV    421 - 490
AHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDT    491 - 560
NECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAA    561 - 630
AAAGAATAAPVLVDGDLNLGSVVKESCEPSC                                           631 - 661
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20803292 2011 Bone morphogenetic protein-7 promotes chondrogenesis in human amniotic epithelial cells.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20382749 2010 Regulated gene expression in cultured type II cells of adult human lung.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20171266 2010 CRTAC1 homolog proteins are conserved from cyanobacteria to man and secreted by the teleost fish pituitary gland.
19952464 2010 Genes up- or down-regulated by high calcium medium in parathyroid tissue explants from patients with primary hyperparathyroidism.
19738042 2009 Glomus tumors in neurofibromatosis type 1: genetic, functional, and clinical evidence of a novel association.
17602227 2007 Detection of bone and cartilage-related proteins in plasma of patients with a bone fracture using liquid chromatography-mass spectrometry.
17460260 2007 Comparative analysis of human conjunctival and corneal epithelial gene expression with oligonucleotide microarrays.
17074475 2007 Chondrocyte secreted CRTAC1: a glycosylated extracellular matrix molecule of human articular cartilage.
17013738 2006 Sonic hedgehog protein promotes proliferation and chondrogenic differentiation of bone marrow-derived mesenchymal stem cells in vitro.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054597 2002 Molecular analysis of expansion, differentiation, and growth factor treatment of human chondrocytes identifies differentiation markers and growth-related genes.
11139377 2001 Chondrocyte expressed protein-68 (CEP-68), a novel human marker gene for cultured chondrocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.