Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.50
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.100 3.2e-04
astrocytic glioma -1.500 5.3e-03
Astrocytoma, Pilocytic -1.800 2.5e-04
atypical teratoid / rhabdoid tumor -3.400 2.7e-12
ependymoma -2.500 1.2e-13
glioblastoma -2.300 5.4e-07
group 3 medulloblastoma -2.500 1.3e-03
interstitial cystitis -3.400 4.4e-04
lung adenocarcinoma -1.200 2.6e-07
lung cancer -1.400 1.1e-03
lung carcinoma -1.800 3.8e-13
medulloblastoma, large-cell -2.500 2.8e-04
non-small cell lung cancer -1.768 7.3e-21
oligodendroglioma 1.100 8.4e-03
ovarian cancer 1.400 9.0e-05
primitive neuroectodermal tumor -2.700 2.3e-03

Gene RIF (7)

AA Sequence

MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFE      1 - 70
IVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFS     71 - 140
GVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIE    141 - 210
MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAA    211 - 280
ASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVIT    281 - 350
ADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL    351 - 420
ILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPV    421 - 490
AHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDT    491 - 560
NECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAA    561 - 630
AAAGAATAAPVLVDGDLNLGSVVKESCEPSC                                           631 - 661
//

Text Mined References (24)

PMID Year Title