Property Summary

NCBI Gene PubMed Count 1,722
PubMed Score 33883.52
PubTator Score 27912.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00147562432363213
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0297873987228589
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 6.934 3.5
Hypertension 293 6.4 3.2
Kidney disease 397 6.26 3.1
Cerebrovascular disease 231 6.194 3.1
Pneumonia 133 6.088 3.0
Heart disease 279 6.07 3.0
Appendicitis 18 5.995 3.0
Crohn's disease 304 5.915 3.0
Ankylosing spondylitis 138 5.85 2.9
Anemia 252 5.667 2.8
Lipid metabolism disorder 102 5.63 2.8
Vasculitis 64 5.598 2.8
Cancer 2346 5.442 2.7
Osteomyelitis 20 5.387 2.7
ulcerative colitis 2087 5.369 2.7
Septic arthritis 8 5.291 2.6
Hypersensitivity reaction type II disease 235 5.252 2.6
Pancreatitis 97 5.234 2.6
Chronic obstructive pulmonary disease 147 5.176 2.6
Kawasaki disease 24 5.075 2.5
Obstructive sleep apnea 28 5.006 2.5
Acute cystitis 37 4.942 2.5
Synovitis 72 4.903 2.5
tuberculosis 1563 4.838 2.4
Arthropathy 34 4.817 2.4
Leukopenia 42 4.738 2.4
Epidural abscess 2 4.699 2.3
Psoriatic arthritis 85 4.681 2.3
Osteoarthritis 96 4.65 2.3
Polycystic Ovary Syndrome 335 4.632 2.3
Peripheral artery disease 8 4.564 2.3
Peritonitis 37 4.522 2.3
Takayasu's arteritis 54 4.491 2.2
Diarrhea 155 4.442 2.2
Collagen disease 25 4.431 2.2
Chorioamnionitis 15 4.402 2.2
Exanthem 39 4.364 2.2
Liver disease 219 4.355 2.2
Fatty liver disease 86 4.3 2.2
Hyperglycemia 120 4.273 2.1
Pyuria 6 4.261 2.1
Myopathy 128 4.255 2.1
Diverticulitis 8 4.207 2.1
Peripheral vascular disease 90 4.066 2.0
Cholecystitis 8 4.065 2.0
adult-onset Still's disease 6 4.061 2.0
Respiratory failure 30 4.018 2.0
Rheumatic fever 16 4.001 2.0
Aortic aneurysm 34 3.941 2.0
Influenza 142 3.936 2.0
Thrombocytopenia 105 3.928 2.0
Aortitis 4 3.893 1.9
Pericarditis 14 3.854 1.9
Pelvic inflammatory disease 21 3.831 1.9
Hyperhomocysteinemia 34 3.83 1.9
Human immunodeficiency virus infectious disease 129 3.821 1.9
Tonsillitis 18 3.794 1.9
Cellulitis 13 3.771 1.9
Brucellosis 24 3.731 1.9
Mediastinitis 7 3.73 1.9
Transient cerebral ischemia 14 3.716 1.9
Bacteriuria 13 3.7 1.8
Amyloidosis 68 3.644 1.8
Bronchitis 44 3.642 1.8
Asthma 349 3.63 1.8
Hypothyroidism 89 3.618 1.8
Major Depressive Disorder 106 3.591 1.8
Pharyngitis 17 3.565 1.8
Hyperuricemia 35 3.543 1.8
Gout 93 3.532 1.8
Pulmonary Embolism 45 3.513 1.8
Dementia 129 3.496 1.7
Intestinal obstruction 16 3.484 1.7
Osteoporosis 259 3.484 1.7
Pleural empyema 10 3.481 1.7
Reactive arthritis 7 3.481 1.7
Intermittent claudication 16 3.469 1.7
Pericardial effusion 10 3.469 1.7
Perinatal necrotizing enterocolitis 18 3.405 1.7
interstitial lung disease 292 3.392 1.7
Limb ischemia 12 3.375 1.7
cystic fibrosis 1670 3.374 1.7
Uveitis 103 3.371 1.7
Thrombophilia 37 3.347 1.7
Brain disease 84 3.331 1.7
protein-energy malnutrition 8 3.324 1.7
Gastroenteritis 46 3.305 1.7
Bronchiectasis 29 3.239 1.6
Chlamydia 18 3.227 1.6
Subacute thyroiditis 5 3.217 1.6
Hyperinsulinism 63 3.205 1.6
Cervical adenitis 3 3.201 1.6
Necrotizing fasciitis 9 3.2 1.6
Urticaria 53 3.198 1.6
Vesicoureteral reflux 28 3.184 1.6
Neuropathy 210 3.141 1.6
Funisitis 8 3.117 1.6
Neurodegenerative disease 383 3.057 1.5
Hyperandrogenism 32 3.052 1.5
Subdural empyema 7 3.044 1.5
Epididymitis 7 3.042 1.5
Age related macular degeneration 84 3.02 1.5
Henoch-Schoenlein purpura 13 3.008 1.5
Bilirubin metabolic disorder 39 3.006 1.5

Expression

Synonym

Accession P02741 A8K078 D3DVD9 D3DVE0 Q08AK3 Q8WW75
Symbols PTX1

Gene

CRP

PDB

1B09   1CRV   1GNH   1LJ7   3L2Y   3PVN   3PVO  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Gene RIF (1776)

PMID Text
27333717 CPR level was correlated with COPD severity.
27295905 Increased serum and drainage fluid CRP after colorectal anastomosis is associated with anastomotic leak.
27096761 The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases.
27049070 serum levels of c-reactive protein (CRP) and [acutephysiology and chronic health evaluation II score and sequential organ failure assessment score, functional independence measure and Barthel index of activities of daily living, were assessed.
27044366 Neutrophilic asthma patients had raised CRP compared to eosinophilic asthma patients and controls.
27022914 high levels of PAI-1 are detected when D allele is present, whereas greater interdialytic gain is associated with the presence of I allele.
26963617 cardioprotective effects of metformin might be especially effective in diabetic patients with high levels of CRP.
26942752 CRP is a poor predictor of the occurrence of microbial invasion of the amniotic cavity and histological chorioamnionitis, even at early gestational ages.
26871443 Inverse association has been found between plasma IgG antibody to Aggregatibacter actinomycetemcomitans and high CRP levels in patients with metabolic syndrome and periodontitis.
26850725 ANGPTL8 is increased in subjects with MetS and it was significantly associated with HsCRP levels in different subgroups.
More...

AA Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIF      1 - 70
SYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLK     71 - 140
KGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKY    141 - 210
EVQGEVFTKPQLWP                                                            211 - 224
//

Text Mined References (1723)

PMID Year Title
27333717 2016 CORRELATION OF C-REACTIVE PROTEIN AND COPD SEVERITY.
27295905 2016 C-reactive protein in drainage fluid as a predictor of anastomotic leakage after elective colorectal resection.
27096761 2016 Prospective Evaluation of Procalcitonin, Soluble Triggering Receptor Expressed on Myeloid Cells-1 and C-Reactive Protein in Febrile Patients with Autoimmune Diseases.
27049070 C-reactive protein correlates to functional score systems of patients in general surgical intensive care unit.
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
27022914 2016 Influence of ACE I/D Polymorphism on Circulating Levels of Plasminogen Activator Inhibitor 1, D-Dimer, Ultrasensitive C-Reactive Protein and Transforming Growth Factor ?1 in Patients Undergoing Hemodialysis.
26963617 2016 Effects of Metformin on Tissue Oxidative and Dicarbonyl Stress in Transgenic Spontaneously Hypertensive Rats Expressing Human C-Reactive Protein.
26942752 2016 Maternal Serum C-Reactive Protein in Women with Preterm Prelabor Rupture of Membranes.
26871443 2016 Inverse Association of Plasma IgG Antibody to Aggregatibacter actinomycetemcomitans and High C-Reactive Protein Levels in Patients with Metabolic Syndrome and Periodontitis.
26850725 2016 Circulating angiopoietin-like protein 8 (betatrophin) association with HsCRP and metabolic syndrome.
More...