Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.09
PubTator Score 10.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 2.0e-04
astrocytic glioma -1.200 3.8e-02
glioblastoma 1.400 4.7e-02
interstitial cystitis -1.500 3.6e-03
intraductal papillary-mucinous carcinoma... 1.100 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.4e-02
invasive ductal carcinoma 1.400 1.0e-03
malignant mesothelioma -5.800 6.9e-08
osteosarcoma 1.058 2.6e-02
ovarian cancer -1.300 2.7e-05
subependymal giant cell astrocytoma 1.581 1.7e-02
ulcerative colitis -1.400 2.8e-04

 GWAS Trait (2)

Protein-protein Interaction (5)

Gene RIF (6)

AA Sequence

MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKL      1 - 70
LERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLR     71 - 140
KEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGC    141 - 210
LVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMED    211 - 280
SSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNE    281 - 350
GRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI    351 - 420
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKH    421 - 490
NKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVH    491 - 560
NGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHL                      561 - 612
//

Text Mined References (19)

PMID Year Title