Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.83
PubTator Score 10.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -5.800 6.9e-08
astrocytic glioma -1.200 3.8e-02
osteosarcoma 1.058 2.6e-02
glioblastoma 1.400 4.7e-02
intraductal papillary-mucinous carcinoma... 1.100 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.4e-02
interstitial cystitis -2.000 6.2e-05
pediatric high grade glioma 1.100 5.3e-04
subependymal giant cell astrocytoma 1.581 1.7e-02
invasive ductal carcinoma 1.400 1.0e-03
ulcerative colitis -1.400 2.8e-04
ovarian cancer -1.300 2.7e-05

Protein-protein Interaction (6)

Gene RIF (6)

PMID Text
21619872 These results suggest that CROT activity, by controlling the peroxisomal amount of medium chain acyls, may control the peroxisomal oxidative pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19054068 Selected 'Tpl2/Cot-YL ribozyme' efficiently cleaves its target sequence in cis and in trans; furthermore, the ribozyme efficiently cleaves a longer target sequence of 54 nucleotides in trans, as well as the full-length mRNA.
11001805 CROT encodes carnitine octanoyltransferase, an enzyme known from rat studies to act on products of peroxisomal fatty acid oxidation. Medium-chain acylcarnitines are thought to be transported from peroxisomes to mitochondria.
11001805 Human CPT1A, CPT1B, CPT2, CROT and CRAT are known to encode active carnitine acyltransferases. Earlier pfam annotations refer to the non-existing compound CARNITATE. In 2000 this has been changed to CARNITINE.

AA Sequence

MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKL      1 - 70
LERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLR     71 - 140
KEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGC    141 - 210
LVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMED    211 - 280
SSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNE    281 - 350
GRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI    351 - 420
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKH    421 - 490
NKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVH    491 - 560
NGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHL                      561 - 612
//

Text Mined References (19)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21619872 2011 Changes in carnitine octanoyltransferase activity induce alteration in fatty acid metabolism.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19054068 2009 In vitro selection of adenine-dependent ribozyme against Tpl2/Cot oncogene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790793 2002 Structural model of a malonyl-CoA-binding site of carnitine octanoyltransferase and carnitine palmitoyltransferase I: mutational analysis of a malonyl-CoA affinity domain.
11001805 Genomics of the human carnitine acyltransferase genes.
10486279 1999 Molecular cloning and expression of human carnitine octanoyltransferase: evidence for its role in the peroxisomal beta-oxidation of branched-chain fatty acids.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8619474 1996 A "double adaptor" method for improved shotgun library construction.