Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.85
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.4e-03
cystic fibrosis 1696 8.1e-03
esophageal adenocarcinoma 737 1.9e-02
lung cancer 4740 2.2e-02
spina bifida 1074 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 1.500 8.1e-03
esophageal adenocarcinoma -5.100 1.9e-02
lung cancer -4.700 2.2e-02
nasopharyngeal carcinoma -1.900 1.4e-03
spina bifida -1.950 4.3e-02

Gene RIF (10)

AA Sequence

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVE      1 - 70
FKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS     71 - 140
QQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPER    141 - 210
QPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQ    211 - 280
AVTGGHAQIQAGTHTQTPTQTVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQ    281 - 350
AGSHTETVEQDRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST    351 - 420
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYL    421 - 490
RSTKP                                                                     491 - 495
//

Text Mined References (29)

PMID Year Title