Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.94
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -5.100 1.9e-02
lung cancer -4.700 2.2e-02
cystic fibrosis 1.500 8.1e-03
nasopharyngeal carcinoma -1.900 1.4e-03
spina bifida -1.950 4.3e-02

Synonym

Accession Q9UBG3 B2RE60 Q8N613
Symbols DRC1
PDRC1
SEP53
C1orf10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
24263008 Loss of CRNN expression correlated with advanced tumor length, greater tumor invasion depth, lymph node metastasis, and poor survival in patients with esophageal squamous cell carcinoma.
23894350 Findings demonstrate that CRNN is a tumor suppressor gene that plays a critical tumor suppressive role in ESCC.
22560086 cornulin is an important molecule in normal esophageal pathology and is likely lost during the conversion of normal to neoplastic epithelium
20412117 Negative regulation of SIRT1 by DBC1 may retard tumorigenesis in breast tissue, so the correlation between SIRT1 and DBC1 is a potential prognostic indicator in breast cancer.
19558548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19133922 CRNN mRNA expression is decreased in eczematous skin
18465210 Results describe the cloning of porcine SEP53, its homology to the human protein, and its expression in the esophagus and in gastric squamous epithelium.
17925851 SEP53 may be a component of the mucosal/epithelial innate immune response engaged in an ongoing interaction with a pathogen

AA Sequence

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVE      1 - 70
FKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS     71 - 140
QQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPER    141 - 210
QPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQ    211 - 280
AVTGGHAQIQAGTHTQTPTQTVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQ    281 - 350
AGSHTETVEQDRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST    351 - 420
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYL    421 - 490
RSTKP                                                                     491 - 495
//

Text Mined References (27)

PMID Year Title
24263008 2014 Loss of CRNN expression is associated with advanced tumor stage and poor survival in patients with esophageal squamous cell carcinoma.
23894350 2013 Characterization of tumor suppressive function of cornulin in esophageal squamous cell carcinoma.
23568457 2013 Genetic variants associated with disordered eating.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22560086 2013 Downregulation of cornulin in esophageal squamous cell carcinoma.
20412117 2010 Balance between SIRT1 and DBC1 expression is lost in breast cancer.
19558548 2009 Genetic variants of C1orf10 and risk of esophageal squamous cell carcinoma in a Chinese population.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19133922 2009 Cornulin, a marker of late epidermal differentiation, is down-regulated in eczema.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18465210 2008 An animal model to evaluate the function and regulation of the adaptively evolving stress protein SEP53 in oesophageal bile damage responses.
17925851 2007 Adaptive evolution of a stress response protein.
17289885 2007 Decreased expression of gene cluster at chromosome 1q21 defines molecular subgroups of chemoradiotherapy response in esophageal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16640557 2006 The calcium-binding domain of the stress protein SEP53 is required for survival in response to deoxycholic acid-mediated injury.
16466100 2006 Effect of pepsin on laryngeal stress protein (Sep70, Sep53, and Hsp70) response: role in laryngopharyngeal reflux disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15896671 2005 Chromosome 1 open reading frame 10 (C1orf10) gene is frequently down-regulated and inhibits cell proliferation in oral squamous cell carcinoma.
15854041 2005 Cornulin, a new member of the "fused gene" family, is expressed during epidermal differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14967811 2004 The Barrett's antigen anterior gradient-2 silences the p53 transcriptional response to DNA damage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11606197 2001 The human oesophageal squamous epithelium exhibits a novel type of heat shock protein response.
11056050 2000 Novel human esophagus-specific gene c1orf10: cDNA cloning, gene structure, and frequent loss of expression in esophageal cancer.
2980212 1988 Immunohistochemical study of Warthin's tumour with special regard to the germinal centre.
2631556 1989 Intercellular contacts between germinal center cells. Mechanisms of adhesion between lymphoid cells and follicular dendritic cells.