Property Summary

NCBI Gene PubMed Count 39
PubMed Score 39.04
PubTator Score 110.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.511 8.1e-04
posterior fossa group B ependymoma -1.500 1.9e-07
atypical teratoid/rhabdoid tumor -1.100 1.6e-02
group 4 medulloblastoma 1.100 2.8e-04
lung carcinoma 2.700 1.4e-32
spina bifida 1.674 3.8e-02

 GWAS Trait (1)

Gene RIF (25)

PMID Text
26598519 These results demonstrate an important role for CRMP-1 in Listeria actin comet tail formation and open the possibility that CRMP-1 controls cell motility by modulating Arp2/3 activation.
26249678 Human CRMP-1 comprises a tetrameric assembly.
26032958 The mitochondrial fragmentation protein DRP1 play a role in the development of malignant melanoma.
26009886 Results show that expression of CRMP1 is downregulated in medulloblastoma (MB) tumors. its overexpression inhibits proliferation, migration and invasion of cells suggesting that CRMP1 is implicated in MB pathogenesis.
25908449 CRMP1 targets aggregation-prone, N-terminal HTT fragments and suppresses their spontaneous self-assembly.
25526860 CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush.
25194153 Aberrant upregulation of CRMP-1 expression may link to the mechanism of developing early-onset preeclampsia.
22798627 CRMP1 is a novel candidate protein for schizophrenia traits
22363707 GSK3beta-dependent phosphorylation of LCRMP-1 provides an important mechanism for regulation of LCRMP-1 on cancer cell invasiveness and clinical outcome.
22359051 in pilocarpine-induced animal model of epilepsy, CRMP-1 dynamically decreased in a range of 2 months. Thus, our results indicate that CRMP-1 may be involved in the development of TLE
21747164 LCRMP-1 and CRMP-1 have opposing functions in regulating cancer cell invasion and metastasis
20506281 Data demonstrate that CRMP1 tyrosine 504 is a primary target of the Src family of tyrosine kinases (SFKs), specifically Fyn.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20087401 Observational study of gene-disease association. (HuGE Navigator)
19903856 loss of CRMP1 contribute to the increased invasive phenotype of human Glioblastoma multiforme brain tumors expressing mutant EGFRvIII.
19362386 LCRMP-1 was a cancer invasion enhancer that could be a novel prognostic biomarker in non-small cell lung cancer.
18782567 ChIP and EMSA demonstrated that p50 binds to a kappaB site residing between -1753 and -1743 of the CRMP-1 promoter region.
18524846 Transcription of the invasion suppressor, CRMP-1, is reciprocally regulated at the promoter region by C/EBPalpha and Sp1.
17118363 The collapsin response mediator protein 1 and the promyelocytic leukemia zinc finger protein interact with UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE).
16611631 GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms
16169070 The CRMP1 protein is characterizing as modulators of Wnt protein signaling of Axin-1.
15492864 CRMP1 and EVC genes are located near WFS1, the Wolfram syndrome type 1 gene.
14996858 CTGF inhibits metastasis and invasion of human lung adenocarcinoma by a CRMP-1-dependent mechanism.
12650609 Collapsin response mediator protein-1: a novel invasion-suppressor gene.
12482610 CRMP-1 and CRMP-2 have a role in RhoA-dependent signaling, through interaction with and regulation of ROKalpha

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGI      1 - 70
DVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVD     71 - 140
ITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQK    141 - 210
RILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA    211 - 280
ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTL    281 - 350
IPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI    351 - 420
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFG    421 - 490
LQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA    491 - 560
PPGGRSNITSLG                                                              561 - 572
//

Text Mined References (43)

PMID Year Title
26598519 2016 Collapsin Response Mediator Protein-1 Regulates Arp2/3-dependent Actin Assembly.
26249678 2015 Structure of human collapsin response mediator protein 1: a possible role of its C-terminal tail.
26032958 2015 Activation of the Mitochondrial Fragmentation Protein DRP1 Correlates with BRAF(V600E) Melanoma.
26009886 2015 CRMP1 Inhibits Proliferation of Medulloblastoma and Is Regulated by HMGA1.
25908449 2015 Systematic interaction network filtering identifies CRMP1 as a novel suppressor of huntingtin misfolding and neurotoxicity.
25526860 2016 CRMP1 Interacted with Spy1 During the Collapse of Growth Cones Induced by Sema3A and Acted on Regeneration After Sciatic Nerve Crush.
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
25194153 2015 Expression of collapsin response mediator protein 1 in placenta of normal gestation and link to early-onset preeclampsia.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22798627 2012 Proteomic, genomic and translational approaches identify CRMP1 for a role in schizophrenia and its underlying traits.
22363707 2012 Phosphorylation of LCRMP-1 by GSK3? promotes filopoda formation, migration and invasion abilities in lung cancer cells.
22359051 2012 Down-regulation of CRMP-1 in patients with epilepsy and a rat model.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21747164 2011 The ability of LCRMP-1 to promote cancer invasion by enhancing filopodia formation is antagonized by CRMP-1.
20506281 2010 Fyn promotes phosphorylation of collapsin response mediator protein 1 at tyrosine 504, a novel, isoform-specific regulatory site.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20087401 2010 Association between genes on chromosome 4p16 and non-syndromic oral clefts in four populations.
19903856 2009 Loss of collapsin response mediator Protein1, as detected by iTRAQ analysis, promotes invasion of human gliomas expressing mutant EGFRvIII.
19799413 2009 From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
19362386 2010 Long form collapsin response mediator protein-1 (LCRMP-1) expression is associated with clinical outcome and lymph node metastasis in non-small cell lung cancer patients.
18782567 2008 NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells.
18524846 2008 Modulation of the expression of the invasion-suppressor CRMP-1 by cyclooxygenase-2 inhibition via reciprocal regulation of Sp1 and C/EBPalpha.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17118363 2006 The collapsin response mediator protein 1 (CRMP-1) and the promyelocytic leukemia zinc finger protein (PLZF) bind to UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE), the key enzyme of sialic acid biosynthesis.
16611631 2006 Distinct priming kinases contribute to differential regulation of collapsin response mediator proteins by glycogen synthase kinase-3 in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15492864 2004 Haplotype and linkage disequilibrium analysis of the CRMP1 and EVC genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14996858 2004 Connective tissue growth factor and its role in lung adenocarcinoma invasion and metastasis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12650609 2003 Collapsin response mediator protein-1: a novel invasion-suppressor gene.
12482610 2002 p80 ROKalpha binding protein is a novel splice variant of CRMP-1 which associates with CRMP-2 and modulates RhoA-induced neuronal morphology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11562390 2001 Collapsin response mediator protein-1 and the invasion and metastasis of cancer cells.
10048489 1998 Genomic organization and localization of the human CRMP-1 gene.
9375656 1997 Brain CRMP forms heterotetramers similar to liver dihydropyrimidinase.
8973361 1996 A novel gene family defined by human dihydropyrimidinase and three related proteins with differential tissue distribution.
7637782 1995 Collapsin-induced growth cone collapse mediated by an intracellular protein related to UNC-33.