Property Summary

NCBI Gene PubMed Count 44
PubMed Score 40.76
PubTator Score 110.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Social Anhedonia 2
Disease Target Count P-value
lung carcinoma 2843 1.4e-32
ependymoma 4679 1.6e-06
group 4 medulloblastoma 1855 2.8e-04
osteosarcoma 7950 8.1e-04
atypical teratoid/rhabdoid tumor 357 1.6e-02
spina bifida 1074 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
lung cancer 4740 3.01 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 1.6e-02
ependymoma -1.200 1.6e-06
group 4 medulloblastoma 1.100 2.8e-04
lung carcinoma 2.700 1.4e-32
osteosarcoma 1.511 8.1e-04
spina bifida 1.674 3.8e-02

Gene RIF (29)

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGI      1 - 70
DVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVD     71 - 140
ITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQK    141 - 210
RILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA    211 - 280
ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTL    281 - 350
IPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI    351 - 420
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFG    421 - 490
LQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA    491 - 560
PPGGRSNITSLG                                                              561 - 572
//

Text Mined References (47)

PMID Year Title