Property Summary

NCBI Gene PubMed Count 50
PubMed Score 67.89
PubTator Score 79.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 4.3e-05
tuberculosis -3.300 3.8e-09
psoriasis 1.300 7.0e-29

Gene RIF (45)

PMID Text
26754556 In adult B-cell acute lymphoblastic leukemia without recurrent fusion genes , high CRLF2 expression is associated with distinct clinico-biological features and an unfavourable prognosis
26288354 CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody
25676453 The levels of mRNA for TSLP and TSLPR were significantly elevated in parotid gland tissues from the KD group as compared to the control group.
25044358 Differences exist in the genetic profiles of Down syndrome-associated acute lymphoblastic leukemia patients in Japan and in Western countries, and that P2RY8-CRLF2 and EBF1 deletions may cooperate in leukemogenesis in a subset of Japanese DS-ALL patients.
24935070 CRLF2 overexpression (OE) was detected in 30 (18%) of 167 patients, the P2RY8-CRLF2 fusion was identified in only 3 (1.8%) of 167 patients, all of which demonstrated CRLF2 OE.
24787007 we report noncysteine in-frame mutations in IL7R and CRLF2 located in a region of the transmembrane domain closer to the cytosolic domain in acute lymphoblastic leukemias
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of cytokine receptor-like factor 2 (CRLF2) in primary human brain microvascular endothelial cells
24356513 The TSLPR in blood plateltes promotes platelet activation via activating the PI3K/AKT pathway.
24231528 Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases.
24018820 both IKZF1 deletions and IGH@-CRLF2 are associated with an increased risk of treatment failure in adult acute lymphoblastic leukemia
23974192 Higher cumulative incidence of relapse was found for BCR-ABL1-like and IKZF1-deleted, but not CRLF2-high, cases relative to remaining BCP-ALL cases.
23804397 IKZF1 deletions and CRLF2-high expression predicted poor outcomes in patients with HR-ALL but not in patients with SR-ALL in our Japanese cohort
23145900 Results show no clinical or laboratory difference between those with high and low crlf2 expression
23091296 P2RY8-CRLF2-positive clones do not have the necessary proliferative or selective advantage to evolve into a disease-relevant relapse clone.
22915648 CRLF2-overexpressing B-cell acute lymphoblastic leukemias have a gain-of-function CRLF2 F232C mutation or activating mutations in JAK2.
22851563 CRLF2-deregulation and IGH locus translocations represent distinct subtypes of adolescent and adult acute lymphoblastic leukemia.
22484421 Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia.
22441210 Neither CRLF2 nor JAK2 were predictors for worse prognosis in children with Down's syndrome and acute lymphoblastic leukemia.
22382891 CRLF2 overexpression is associated with acute lymphoblastic leukemia.
22368272 High CRLF2 expression is associated with a very poor outcome in high-risk, but not standard-risk, acute lymphoblastic leukemia.
22297722 CRLF2 overexpression is associated with acute lymphoblastic leukemia.
22168549 This review sums up diverse mechanisms that mediate TSLP/TSLP receptor-signalling network in chronic airway diseases.
22150304 review highlights the current knowledge of the incidence, prognostic significance, and biology of CRLF2-overexpressing ALL and future directions for development of targeted therapies
21978707 TSLPR expression was significantly higher in the inflammatory infiltrate and in the epithelial cells of chronic rhinosinusitis with or without nasal polyps
21457190 Data indicate that overexpression of CRLF2 was not observed in adult patients with Ph-positive or T-ALL but was limited to B-ALL patients with a normal diagnostic karyotype.
21169835 Integrated genomic profiling has identified potential therapeutic targets in acute lymphoblastic leukemia, including aberrant cytokine receptor signaling mediated by rearrangements and mutation of CRLF2
21106984 Deregulated expression of CRLF2 (CRLF2-d) arises via its juxtaposition to the IGH@ enhancer or P2RY8 promoter. Among 865 BCP-ALL children treated on MRC ALL97, 52 (6%) had CRLF2-d, but it was more prevalent among Down syndrome patients (54%).
20847213 Studies indicate that of 19 total CRLF2 breakpoints, 7 are directly at CpGs and breakpoints are much closer to CpGs than expected by random chance.
20807819 increased CRLF2 expression associates with JAK2 mutation, a combination that transforms hematopoietic cells, suggesting that mutant JAK2 and CRLF2 may cooperate to contribute to B-progenitor acute lymphoblastic leukemia formation [review]
20663412 The genotype and allele frequencies of the g.33G>C and g.19646A>G of the TSLPR gene were significantly associated in the atopic asthma patients rather than in the non-atopic asthma patients
20663412 Observational study of gene-disease association. (HuGE Navigator)
20483734 The hymic stromal lymphopoietin receptor is involved in the pathogenesis of allergic asthma through the activation of human airway smooth muscle cells by t hymic stromal lymphopoietin
20466416 Observational study of gene-disease association. (HuGE Navigator)
20378752 Study reports an extremely high incidence of relapse (71% +/- 19%) in non-high-risk precursor B-cell acute lymphoblastic leukemia patients with P2RY8-CRLF2 rearrangement.
20236697 Our data indicate that epithelial cells express TSLPR and that TSLP induces bronchial epithelial cell proliferation and increases injury repair through IL-13 production.
20139093 Activation of CRLF2 expression, mutation of of JAK1 or JAK2, and alterations of IKZF1 cooperate to promote B-cell leukemogenesis.
20128689 human TSLP receptor requires the function of JAK1 and JAK2 for STAT activation
20109752 Expression of TSLP receptor was upregulated on atopic DCs primed with H22-Fel d 1 through a pathway regulated by FcgammaRI-associated signaling components.
20096461 Induced homodimerization of receptor chimeras containing the transmembrane and cytoplasmic domains of both human and mouse TSLP receptors is not sufficient for driving cell proliferation.
20018760 Results implicate CRLF2 as an important factor in precursor B-cell acute lymphoblastic leukemia with diagnostic, prognostic, and therapeutic implications.
19965641 Results suggest that the majority of DS children with ALL may benefit from therapy blocking the CRLF2/JAK2 pathways.
19907440 Activating mutation in the TSLPR gene in B-cell precursor lymphoblastic leukemia; results indicate that TSLPR activation may occur independently of a JAK2R683 mutation and that TSLPR can also be the site of a point mutation
19838194 report a recurring interstitial deletion of the pseudoautosomal region 1 of chromosomes X and Y in B-progenitor acute lymphoblastic leukemia that juxtaposes the first, noncoding exon of P2RY8 with the coding region of CRLF2.
19641190 A causal role of CRLF2 overexpression in lymphoid transformation.
17513717 The presence of TSLP receptors is unexpectedly demonstrated on activated human CD4-positive T cells.

AA Sequence

MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQ      1 - 70
CTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSD     71 - 140
LSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQ    141 - 210
RGEIRDACAETPTPPKPKLSKFILISSLAILLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQ    211 - 280
GNFQEWITDTQNVAHLHKMAGAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQG    281 - 350
GDVVTIGGFTFVMNDRSYVAL                                                     351 - 371
//

Text Mined References (51)

PMID Year Title
26754556 2016 CRLF2 overexpression identifies an unfavourable subgroup of adult B-cell precursor acute lymphoblastic leukemia lacking recurrent genetic abnormalities.
26288354 2015 TSLP Directly Interacts with Skin-Homing Th2 Cells Highly Expressing its Receptor to Enhance IL-4 Production in Atopic Dermatitis.
25676453 2015 Increased expression of thymic stromal lymphopoietin and its receptor in Kimura's disease.
25044358 2014 Gene alterations involving the CRLF2-JAK pathway and recurrent gene deletions in Down syndrome-associated acute lymphoblastic leukemia in Japan.
24935070 2014 An overall characterization of pediatric acute lymphoblastic leukemia with CRLF2 overexpression.
24787007 2014 Novel activating mutations lacking cysteine in type I cytokine receptors in acute lymphoblastic leukemia.
24356513 2013 Human platelets express functional thymic stromal lymphopoietin receptors: a potential role in platelet activation in acute coronary syndrome.
24231528 2014 Significance of CD66c expression in childhood acute lymphoblastic leukemia.
24018820 2013 Unravelling the prognostic effect of IKZF1 deletions and IGH@-CRLF2 in adult acute lymphoblastic leukaemia.
23974192 2013 Independent prognostic value of BCR-ABL1-like signature and IKZF1 deletion, but not high CRLF2 expression, in children with B-cell precursor ALL.
23804397 2013 IKZF1 and CRLF2 gene alterations correlate with poor prognosis in Japanese BCR-ABL1-negative high-risk B-cell precursor acute lymphoblastic leukemia.
23145900 2013 No prognostic impact of P2RY8-CRLF2 fusion in intermediate cytogenetic risk childhood B-cell acute lymphoblastic leukaemia.
23091296 2012 Small sizes and indolent evolutionary dynamics challenge the potential role of P2RY8-CRLF2-harboring clones as main relapse-driving force in childhood ALL.
22915648 2012 Differences in signaling through the B-cell leukemia oncoprotein CRLF2 in response to TSLP and through mutant JAK2.
22851563 2012 IGH@ translocations, CRLF2 deregulation, and microdeletions in adolescents and adults with acute lymphoblastic leukemia.
22484421 2012 Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia.
22441210 2012 Outcome in children with Down's syndrome and acute lymphoblastic leukemia: role of IKZF1 deletions and CRLF2 aberrations.
22382891 2012 Newly diagnosed acute lymphoblastic leukemia in China (I): abnormal genetic patterns in 1346 childhood and adult cases and their comparison with the reports from Western countries.
22368272 2012 Outcome modeling with CRLF2, IKZF1, JAK, and minimal residual disease in pediatric acute lymphoblastic leukemia: a Children's Oncology Group study.
22297722 2012 Newly diagnosed acute lymphoblastic leukemia in China (II): prognosis related to genetic abnormalities in a series of 1091 cases.
22168549 2012 Function and mechanisms of TSLP/TSLPR complex in asthma and COPD.
22150304 2011 Understanding the biology of CRLF2-overexpressing acute lymphoblastic leukemia.
21978707 The expression of TSLP receptor in chronic rhinosinusitis with and without nasal polyps.
21457190 2011 Screening for CRLF2 overexpression in adult acute lymphoblastic leukemia.
21169835 2011 How new advances in genetic analysis are influencing the understanding and treatment of childhood acute leukemia.
21106984 2011 Demographic, clinical, and outcome features of children with acute lymphoblastic leukemia and CRLF2 deregulation: results from the MRC ALL97 clinical trial.
20847213 2010 t(X;14)(p22;q32)/t(Y;14)(p11;q32) CRLF2-IGH translocations from human B-lineage ALLs involve CpG-type breaks at CRLF2, but CRLF2/P2RY8 intrachromosomal deletions do not.
20807819 2010 CRLF2 and JAK2 in B-progenitor acute lymphoblastic leukemia: a novel association in oncogenesis.
20663412 2010 Identifying the polymorphisms in the thymic stromal lymphopoietin receptor (TSLPR) and their association with asthma.
20483734 2010 Thymic stromal lymphopoietin receptor-mediated IL-6 and CC/CXC chemokines expression in human airway smooth muscle cells: role of MAPKs (ERK1/2, p38, and JNK) and STAT3 pathways.
20466416 2010 Genetic variants in thymic stromal lymphopoietin are associated with atopic dermatitis and eczema herpeticum.
20378752 2010 Presence of the P2RY8-CRLF2 rearrangement is associated with a poor prognosis in non-high-risk precursor B-cell acute lymphoblastic leukemia in children treated according to the ALL-BFM 2000 protocol.
20236697 2010 Thymic stromal lymphopoietin-induced human asthmatic airway epithelial cell proliferation through an IL-13-dependent pathway.
20139093 2010 Rearrangement of CRLF2 is associated with mutation of JAK kinases, alteration of IKZF1, Hispanic/Latino ethnicity, and a poor outcome in pediatric B-progenitor acute lymphoblastic leukemia.
20128689 Signal transduction by the atopy-associated human thymic stromal lymphopoietin (TSLP) receptor depends on Janus kinase function.
20109752 2010 Targeting allergen to FcgammaRI reveals a novel T(H)2 regulatory pathway linked to thymic stromal lymphopoietin receptor.
20096461 2010 Effects of transmembrane and juxtamembrane domains on proliferative ability of TSLP receptor.
20018760 2010 Functional screening identifies CRLF2 in precursor B-cell acute lymphoblastic leukemia.
19965641 2010 Down syndrome acute lymphoblastic leukemia, a highly heterogeneous disease in which aberrant expression of CRLF2 is associated with mutated JAK2: a report from the International BFM Study Group.
19907440 2010 Activating mutation in the TSLPR gene in B-cell precursor lymphoblastic leukemia.
19838194 2009 Rearrangement of CRLF2 in B-progenitor- and Down syndrome-associated acute lymphoblastic leukemia.
19641190 2009 Deregulated expression of cytokine receptor gene, CRLF2, is involved in lymphoid transformation in B-cell precursor acute lymphoblastic leukemia.
17513717 2007 Cutting edge: direct action of thymic stromal lymphopoietin on activated human CD4+ T cells.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11891057 2002 Cloning of rat thymic stromal lymphopoietin receptor (TSLPR) and characterization of genomic structure of murine Tslpr gene.
11474172 2001 Molecular cloning of a human novel type I cytokine receptor related to delta1/TSLPR.
11418668 2001 Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.
11237741 2001 Identification of a novel type I cytokine receptor CRL2 preferentially expressed by human dendritic cells and activated monocytes.
10872831 2000 Molecular cloning and characterization of CRLM-2, a novel type I cytokine receptor preferentially expressed in hematopoietic cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.