Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.68
PubTator Score 249.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer 2.500 5.1e-04
malignant mesothelioma -6.100 4.1e-09
cystic fibrosis -2.148 7.9e-07
adrenocortical adenoma -1.178 2.1e-02
adrenocortical carcinoma -2.092 4.2e-05
tuberculosis 2.400 1.4e-04
primary pancreatic ductal adenocarcinoma 2.489 5.7e-05
intraductal papillary-mucinous adenoma (... -2.900 1.0e-03
intraductal papillary-mucinous carcinoma... -3.700 6.2e-04
X-linked cerebral adrenoleukodystrophy 2.100 1.5e-02
lung cancer -2.600 3.5e-06
group 4 medulloblastoma -1.100 5.3e-05
pilocytic astrocytoma 1.400 1.9e-04
pancreatic carcinoma 1.200 3.4e-02
lung adenocarcinoma 1.400 1.4e-02
non-inflammatory breast cancer 1.100 3.1e-02
lung carcinoma -1.200 3.4e-05
ulcerative colitis 1.800 8.5e-05
ovarian cancer 3.400 9.2e-05
pituitary cancer -1.600 1.4e-03

Gene RIF (19)

PMID Text
26624800 Our data suggest that CRISPLD2 may have a unique anti-HMGB1 effect via miRNA155 and play an important role in immune balance.
25496823 Results demonstrate genetic polymorphism of CRISPLD2 gene is associated with an increased risk of non-syndromic cleft lip with or without cleft palate.
25480331 findings define a role for LGL1 in fibroblast expansion and migration, epithelial cell migration, and mesenchymal-epithelial signaling, key processes in fetal lung development.
24955763 CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis.
24090571 Both LCCL-domains of human CRISPLD2 have high affinity for lipid A.
23799041 There is a decreased expression of CRISPLD2 in septic shock and it is association with procalcitonin in sepsis.
21800413 CRISPLD2 gene contributes to the etiology of NSCLP in the Northwestern Chinese population. SNP rs1546124 is significantly related to NSCLP, associated with both CL/P and CPO groups, and SNP rs4783099 is significantly associated with CPO.
21254358 These novel findings suggest that CRISPLD1 plays a role in Nonsyndromic cleft lip and palate (NSCLP) through the interaction with CRISPLD2 and folate pathway genes.
21244519 the present investigation did not support the hypothesis of the involvement of CRISPLD2 in nonsyndromic cleft lip and palate
20815724 results support the hypothesis that variants in the CRISPLD2 gene may be involved in the etiology of NS CL(P).
20815724 Observational study of gene-disease association. (HuGE Navigator)
20662919 three SNPs in northern Chinese population found an association between these polymorphisms and NSCLP in both single-marker and haplotype analyses. data further strengthen the conclusion that altered CRISPLD2 is associated with NSCLP susceptibility.
20662919 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19937600 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864597 present work introduces mammal CRISPLD2 as a major serum protein that acts as a natural LPS antagonist and promises to be of considerable preventative value against endotoxic shock.
17616516 Observational study of gene-disease association. (HuGE Navigator)
17616516 CRISPLD2 is expressed in the mandible, palate and nasopharynx regions during craniofacial development at E13.5-E17.5, respectively. Altogether, these data suggest that genetic variation in CRISPLD2 has a role in the etiology of NSCLP.

AA Sequence

MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQV      1 - 70
QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY     71 - 140
PYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEA    141 - 210
PYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSA    211 - 280
VNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDI    281 - 350
TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE    351 - 420
PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSESLGTPRDGKAF    421 - 490
RIFAVRQ                                                                   491 - 497
//

Text Mined References (30)

PMID Year Title
27597766 2016 CRISPLD2 (LGL1) inhibits proinflammatory mediators in human fetal, adult, and COPD lung fibroblasts and epithelial cells.
26624800 2016 HMGB1 induced inflammatory effect is blocked by CRISPLD2 via MiR155 in hepatic fibrogenesis.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
25496823 2015 Preliminary evidence of an interaction between the CRISPLD2 gene and non-syndromic cleft lip with or without cleft palate (nsCL/P) in Xinjiang Uyghur population, China.
25480331 2015 LGL1 modulates proliferation, apoptosis, and migration of human fetal lung fibroblasts.
24955763 2014 CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis.
24090571 2014 Both LCCL-domains of human CRISPLD2 have high affinity for lipid A.
23799041 2013 CRISPLD2 is expressed at low levels during septic shock and is associated with procalcitonin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21800413 2011 The CRISPLD2 gene is involved in cleft lip and/or cleft palate in a Chinese population.
21254358 2011 Nonsyndromic cleft lip and palate: CRISPLD genes and the folate gene pathway connection.
21244519 2011 No evidence for a role of CRISPLD2 in non-syndromic cleft lip with or without cleft palate in an Italian population.
20815724 2011 CRISPLD2 variants including a C471T silent mutation may contribute to nonsyndromic cleft lip with or without cleft palate.
20662919 2010 CRISPLD2 polymorphisms are associated with non-syndromic cleft lip with or without cleft palate in a northern Chinese population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19937600 2010 Testing reported associations of genetic risk factors for oral clefts in a large Irish study population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864597 2009 The novel lipopolysaccharide-binding protein CRISPLD2 is a critical serum protein to regulate endotoxin function.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17616516 2007 CRISPLD2: a novel NSCLP candidate gene.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.