Property Summary

NCBI Gene PubMed Count 45
PubMed Score 42.22
PubTator Score 46.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -3.800 2.6e-02
malignant mesothelioma 1.500 7.7e-05
esophageal adenocarcinoma -4.400 2.1e-02
psoriasis -2.400 8.3e-03
osteosarcoma -8.231 3.8e-10
Atopic dermatitis 1.600 4.6e-02
intraductal papillary-mucinous adenoma (... -4.800 7.0e-04
lung cancer 1.600 1.9e-02
interstitial cystitis -5.800 1.5e-04
non primary Sjogren syndrome sicca 1.300 3.1e-02
mucosa-associated lymphoid tissue lympho... 4.624 1.4e-02
ductal carcinoma in situ 3.600 3.2e-02
ovarian cancer -2.200 2.8e-02
chronic rhinosinusitis 2.402 3.8e-02

Synonym

Accession P54108 A8K9S1 B2R8I8 Q15512 Q3MJ82 Q53FA9 Q5JW83 Q9H108 CRISP-3
Symbols Aeg2
CRS3
SGP28
CRISP-3
dJ442L6.3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (24)

PMID Text
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
25715794 These data suggest roles for epithelial and neutrophil-derived CRISP3 in postmenstrual endometrial repair and regeneration
24978310 up-regulation of the mRNA encoding cysteine-rich secretory protein 3 (CRISP3), a glycoprotein with unknown function that is secreted from multiple exocrine glands, was correlated with HCV resistance.
23375721 terminal beta-strands of PSP94 contact the first alpha-helix and the hinge region of CRISP-3
23196798 Strong CRISP3 expression is associated with unfavorable tumor phenotype and early recurrence in prostate cancers
22993349 MSMB and CRISP3 were widely distributed in ovaries and in ovarian tumors; the expression of MSMB fits well with a tumor-suppressor function in ovarian carcinogenesis.
21814574 up-regulation of CRISP3 is associated with prostate carcinomas with the TMPRSS2-ERG fusion gene.
21240253 We found no correlation between CRISP3 expression and biochemical recurrence.
20680031 Expression levels of AR and CRISP3 were not affected by short-term ADT but were high in castration-resistant prostate cancer (CRPC) and metastases.
20676114 Either PSP94 or CRISP-3 alone can induce growth inhibition in prostate cancer cells in a cell line specific manner.
20625511 Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included decreased CRISP2&3.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20116414 Complex binding of CRISP proteins by A1BG and other proteins may interfere with the detection and function of these proteins.
19282327 Results suggest that absence of a local reduction in expression of CRISP-3 in decidualized endometrium of women with EP may be due to reduced exposure to hCG due to the ectopic location of the trophoblast.
19026612 A tentative structure for the hMSP-CRISP-3 complex using the known crystal structure of triflin as a model of CRISP-3 was presented.
17665393 CRISP-3 pathology occurred in acini remote from lymphocyte foci and may represent some systemic effect in Sjogren Syndrome.
17634540 Predictor of recurrence after radical prostatectomy for localized prostate cancer.
16388501 Strong immunostaining for CRISP-3 is common in high-grade prostatic-intraepithelial-neoplasia and preserved in prostatic csncer.
15950934 Structural similarity with an MSP-binding protein from blood plasma suggests that CRISP-3 binds MSP through its aminoterminal SCP-domain.
15867000 Human CRISP-3 is a quantitatively minor seminal plasma protein not associated with prostasomes. CRISP-3 was found in secretory epithelium throughout the male genital tract, with particularly high expression in cauda epididymis and ampulla vas deferens.
15461460 alpha-1-B glycoprotein-CRISP-3 complex displays a similar function in protecting the circulation from a potentially harmful effect of free CRISP-3
12647793 high levels of CRISP-3 in acinar cells dedifferentiating into small proliferating ductal cells in chronic pancreatitis suggests a role of this molecule in the pathophysiology of chronic pancreatitis
12433721 in situ hybridization experiments indicated that CRISP-3 mRNA is epithelial-specific and is up-regulated in prostate adenocarcinoma compared with benign prostate tissue; a potential biomarker for prostate cancer
12223513 The presence of CRISP-3 in peroxidase-negative granules of neutrophils, in granules of eosinophils, and in exocrine secretions indicates a role in the innate host defense.

AA Sequence

MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAA      1 - 70
ANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYT     71 - 140
QVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYE    141 - 210
DLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY                                       211 - 245
//

Text Mined References (46)

PMID Year Title
27579896 2016 A 7-Gene Signature Depicts the Biochemical Profile of Early Prefibrotic Myelofibrosis.
27440996 2016 Variation in PTCHD2, CRISP3, NAP1L4, FSCB, and AP3B2 associated with spherical equivalent.
27284364 2016 Prognostic value of ERG, PTEN, CRISP3 and SPINK1 in predicting biochemical recurrence in prostate cancer.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26112483 From the epididymis to the egg: participation of CRISP proteins in mammalian fertilization.
25715794 2015 Endometrial CRISP3 is regulated throughout the mouse estrous and human menstrual cycle and facilitates adhesion and proliferation of endometrial epithelial cells.
24978310 2014 Cysteine-rich secretory protein 3 inhibits hepatitis C virus at the initial phase of infection.
24606912 2014 Cysteine- rich secretory protein 3 (CRISP3), ERG and PTEN define a molecular subtype of prostate cancer with implication to patients' prognosis.
24573035 2014 Eukaryotic expression, purification and structure/function analysis of native, recombinant CRISP3 from human and mouse.
23556447 2013 Genes involved in hemorrhagic transformations that follow recombinant t-PA treatment in stroke patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23375721 2013 Mapping of the binding sites involved in PSP94-CRISP-3 interaction by molecular dissection of the complex.
23196798 2013 Cysteine-rich secretory protein 3 overexpression is linked to a subset of PTEN-deleted ERG fusion-positive prostate cancers with early biochemical recurrence.
22993349 2012 The expression of ?-microseminoprotein but not CRISP3 is reduced in ovarian cancer and correlates to survival.
21814574 2011 Cysteine-rich secretory protein-3 (CRISP3) is strongly up-regulated in prostate carcinomas with the TMPRSS2-ERG fusion gene.
21240253 2011 Evaluation of the prognostic significance of MSMB and CRISP3 in prostate cancer using automated image analysis.
20680031 2010 Effect of androgen deprivation therapy on the expression of prostate cancer biomarkers MSMB and MSMB-binding protein CRISP3.
20676114 2010 Growth inhibition mediated by PSP94 or CRISP-3 is prostate cancer cell line specific.
20625511 2010 Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20116414 2010 Human CRISP-3 binds serum alpha(1)B-glycoprotein across species.
19282327 2009 Endometrial cysteine-rich secretory protein 3 is inhibited by human chorionic gonadotrophin, and is increased in the decidua of tubal ectopic pregnancy.
19026612 2009 A model of the complex between human beta-microseminoprotein and CRISP-3 based on NMR data.
18649285 2008 Participation of cysteine-rich secretory proteins (CRISP) in mammalian sperm-egg interaction.
17665393 2007 Low salivary dehydroepiandrosterone and androgen-regulated cysteine-rich secretory protein 3 levels in Sjögren's syndrome.
17634540 2007 Association of cysteine-rich secretory protein 3 and beta-microseminoprotein with outcome after radical prostatectomy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16388501 2006 Immunohistochemical detection of cysteine-rich secretory protein 3 in tissue and in serum from men with cancer or benign enlargement of the prostate gland.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15950934 2005 beta-Microseminoprotein binds CRISP-3 in human seminal plasma.
15867000 Characterization and localization of cysteine-rich secretory protein 3 (CRISP-3) in the human male reproductive tract.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461460 2004 Cysteine-rich secretory protein 3 is a ligand of alpha1B-glycoprotein in human plasma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12647793 2003 Preferential expression of cystein-rich secretory protein-3 (CRISP-3) in chronic pancreatitis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433721 2002 Cysteine-rich secretory protein-3: a potential biomarker for prostate cancer.
12223513 2002 Identification of human cysteine-rich secretory protein 3 (CRISP-3) as a matrix protein in a subset of peroxidase-negative granules of neutrophils and in the granules of eosinophils.
12009203 2002 An ELISA for SGP28/CRISP-3, a cysteine-rich secretory protein in human neutrophils, plasma, and exocrine secretions.
11729383 2001 Identification of disease-specific genes in chronic pancreatitis using DNA array technology.
10614782 1999 The individual regulation of granule protein mRNA levels during neutrophil maturation explains the heterogeneity of neutrophil granules.
8665901 1996 The human cysteine-rich secretory protein (CRISP) family. Primary structure and tissue distribution of CRISP-1, CRISP-2 and CRISP-3.
8601434 1996 SGP28, a novel matrix glycoprotein in specific granules of human neutrophils with similarity to a human testis-specific gene product and a rodent sperm-coating glycoprotein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.