Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.74
PubTator Score 9.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (3)

AA Sequence

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS      1 - 70
HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV                                            71 - 101
//

Text Mined References (21)

PMID Year Title