Property Summary

NCBI Gene PubMed Count 24
PubMed Score 32.66
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
oligodendroglioma -1.300 4.1e-02
psoriasis -2.400 4.5e-05
osteosarcoma -2.649 7.4e-04
group 4 medulloblastoma -2.600 4.9e-06
medulloblastoma, large-cell -1.400 9.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.247 9.1e-03
fascioscapulohumeral muscular dystrophy 1.208 3.9e-04
non-small cell lung cancer -1.272 3.5e-15
lung cancer -4.000 6.6e-06
lung adenocarcinoma -1.700 9.2e-17
lung carcinoma -2.300 3.0e-17
breast carcinoma -1.300 2.9e-31
Breast cancer -2.100 4.0e-10
gastric carcinoma 1.200 9.4e-03
ductal carcinoma in situ -1.500 3.6e-04
invasive ductal carcinoma -2.500 5.3e-04
ovarian cancer -3.100 3.2e-10
pituitary cancer -1.400 2.5e-03
dermatomyositis 1.700 1.7e-03

 CSPA Cell Line (1)

Gene RIF (12)

PMID Text
26653968 These observations provide evidence for the first time that CRIM1 plays a role in cancer cells by enhancing the migration and adhesion and increasing the expression of N-CAD and E-CAD.
25956066 Knock down of CRIM1 had no effect on VEGF-induced proliferation or migration of umbilical vein endothelial cells (HUVECs), indicating that basal CRIM1 is not involved in the proliferation or migration of endothelial cells.
25561690 CRIM1 is the causative gene for Colobomatous macrophthalmia with microcornea syndrome and is important for eye development.
25088037 Data suggest that CRIM1 plays role in cancer progression/metastasis, epithelial-mesenchymal transition, and neoplastic angiogenesis. [REVIEW]
25086356 CRIM1 is an early response gene in the presence of both angiogenic stimulation (VEGF) and environmental (extracellular matrix) factors, and Erk and FAK might be involved in the upregulation of CRIM1 mRNA expression in vascular endothelial cells.
24617547 BMPs inhibitor CRIM1 is increased and correlates with higher levels of serum PIPIII showing an imbalance in favor of pro-fibrotic mechanisms in CHF.
21036735 Study demonstrated that CRIM1 is expressed at high levels in resistant leukemia cells, indicating that CRIM1 may play a role in drug-resistance.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19260139 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of cysteine rich transmembrane BMP regulator 1 (CRIM1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12805376 CRIM1 modulates BMP activity by affecting its processing and delivery to the cell surface
12464430 CRIM1 has a role in capillary formation and maintenance during angiogenesis

AA Sequence

MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQR      1 - 70
NESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKC     71 - 140
ECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRC    141 - 210
VCNPAGCLRKVCQPGNLNILVSKASGKPGECCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLT    211 - 280
ADGCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFR    281 - 350
MDNCRFCRCQGGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD    351 - 420
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGKDCINGFKRDH    421 - 490
NGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCRPIICDKYCPLGLLKNKHGCD    491 - 560
ICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAGPPILSGTCLTVDGHHHKNEESWHDGCRECY    561 - 630
CLNGREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQ    631 - 700
CTCHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPD    701 - 770
VCTSCICIDSVISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC    771 - 840
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVPLWPTPSENDI    841 - 910
VHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFINQKKQWIPLLCWYRTPTKPS    911 - 980
SLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV                  981 - 1036
//

Text Mined References (26)

PMID Year Title
26653968 2015 CRIM1, a newfound cancer-related player, regulates the adhesion and migration of lung cancer cells.
25956066 2015 Inhibition of the proliferation and acceleration of migration of vascular endothelial cells by increased cysteine-rich motor neuron 1.
25561690 2015 CRIM1 haploinsufficiency causes defects in eye development in human and mouse.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25088037 2014 CRIM1, the antagonist of BMPs, is a potential risk factor of cancer.
25086356 2014 Induction of cysteine-rich motor neuron 1 mRNA expression in vascular endothelial cells.
24617547 2014 Fibrosis markers and CRIM1 increase in chronic heart failure of increasing severity.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21220699 2011 Invertebrate hematopoiesis: an astakine-dependent novel hematopoietic factor.
21067317 2011 Network-like impact of MicroRNAs on neuronal lineage differentiation of unrestricted somatic stem cells from human cord blood.
21042576 2010 miRNA-mediated functional changes through co-regulating function related genes.
21036735 2010 CRIM1 is expressed at higher levels in drug-resistant than in drug-sensitive myeloid leukemia HL60 cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12805376 2003 CRIM1 regulates the rate of processing and delivery of bone morphogenetic proteins to the cell surface.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464430 2002 CRIM1 is involved in endothelial cell capillary formation in vitro and is expressed in blood vessels in vivo.
11084657 2000 Characterisation of Crim1 expression in the developing mouse urogenital tract reveals a sexually dimorphic gonadal expression pattern.
10642437 2000 CRIM1, a novel gene encoding a cysteine-rich repeat protein, is developmentally regulated and implicated in vertebrate CNS development and organogenesis.