Property Summary

Ligand Count 1,163
NCBI Gene PubMed Count 239
PubMed Score 726.49
PubTator Score 413.49

Knowledge Summary

Patent (23,031)

TINX Plot

  Disease (7)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-06
atypical teratoid / rhabdoid tumor -1.500 1.5e-09
ependymoma -1.200 1.5e-13
glioblastoma -1.400 6.4e-06
medulloblastoma, large-cell -1.300 4.8e-04
Pilocytic astrocytoma -1.100 1.0e-06
primitive neuroectodermal tumor -1.600 3.8e-06
psoriasis -2.200 1.1e-62

Protein-protein Interaction (2)

Gene RIF (217)

AA Sequence

MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPA      1 - 70
FFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVL     71 - 140
FLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVH    141 - 210
QSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKL    211 - 280
YYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP    281 - 350
LLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV    351 - 420
ARAMSIPTSPTRVSFHSIKQSTAV                                                  421 - 444
//

Text Mined References (244)

PMID Year Title