Property Summary

NCBI Gene PubMed Count 225
PubMed Score 704.18
PubTator Score 413.49

Knowledge Summary

Patent (23,031)

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 1.5e-13
atypical teratoid / rhabdoid tumor -1.500 1.5e-09
glioblastoma -1.400 6.4e-06
medulloblastoma, large-cell -1.300 4.8e-04
primitive neuroectodermal tumor -1.600 3.8e-06
adult high grade glioma -1.500 2.3e-06
pilocytic astrocytoma -1.100 1.0e-06
psoriasis -2.200 1.1e-62

Gene RIF (203)

PMID Text
26940669 hsa-miR-34a can regulate the CRH/CRHR1/POMC axis and may influence body mass index.
26206446 The CRHR1 gene reduces the risk for depressive symptoms among youths living in families undergoing high levels of economic hardship.
26115868 CAL can regulate the anterograde trafficking, the internalization as well as the signaling of CRFR1 via modulating the post-translational modifications that the receptor undergoes at the Golgi apparatus.
25960164 CRF-R1 activation by CRF and UCN inhibits the proliferation of SK-N-SH (N) cells and promotes neuronal-like differentiation.
25954915 The results suggested no association between the CRHR1 gene single nucleotide polymorphisms and infantile spasms in a Chinese population.
25802844 The involvement of CRHR1 in ND.
25712009 CRHR1 gene SNP rs242941 polymorphism is associated with better response to systemic corticosteroid during acute exacerbation of asthma.
25648046 results found that among children with no copies of the protective CRHR1 TAT haplotype, children of mothers with a history of Manic Depressive Disorder had significantly higher levels of brooding than children of mothers with no history of depression.
25640828 The results revealed that changes in depressive symptoms over time depended on both intervention group and genotypes (5-HTTLPR and CRHR1).
25630718 the present study demonstrates that the expression of CRH/CRH-R1 in lesions of chronic plaque psoriasis is lower than that in psoriatic perilesional skin and normal control skin.
25575243 CRF1 antagonist treatment attenuated only the effects on startle induced by CNS-specific CRF overexpression. Specific deletion of CRF1 receptors from forebrain principal neurons failed to alter the effects of exogenous CRF or stress on startle.
25556110 Study provides data pointing out the critical role of corticotropin-releasing factor, through CRF1R, in the positive reinforcing effects of morphine and in morphine-conducted behaviours
25541005 Our data indicate that GG-homozygotes of CRHR1 rs110402 and rs242924 represent a genetically driven subtype of early WM impairments due to alterations in hippocampal CRHR1 activation.
25422958 CRHR1 A alleles are associated with greater depressive reactivity to chronic stress for those also exposed to high levels of early adversities.
25254562 High CRHR1 expression was significantly associated with the risk of recurrence in endometrial carcinoma.
25015995 As in the model of colitis-associated cancer mice, slices from colorectal cancer patients also displayed enhancement of CRHR1 expression in the carcinomatous tissues compared with normal and pericarcinomatous tissues
24985398 High serum corticotropin-releasing hormone (CRH) and bone marrow mast cell CRH receptor expression in a mastocytosis patient.
24966326 we show that the corticotropin-releasing factor receptor type 1 has a specific monomer/dimer equilibrium that is already established in the endoplasmic reticulum
24931706 Specific CRHR1 polymorphisms moderate the effect of early life stress experience on working memory performance.
24838244 structural-functional analysis of the third transmembrane domain of the corticotropin-releasing factor type 1 receptor
24741566 The analysed candidate haplotypes in FKBP5, NR3C1, and CRHR1 did not show an association with depression scores as assessed by EPDS in this cohort of healthy unselected pregnant women.
24703172 CRHR1 variation may moderate the downstream effects of child maltreatment on HPA axis function
24687410 CRF1 receptor knockout does not influence recognition memory in drug-naive mice. object recognition deficits induced by cocaine are unaffected by CRF1 receptor-KO. However, there is an anxiety-like vulnerability to cocaine in CRF1 knockouts.
24623788 This work provides support for a model in which CRHR1 gene variation modulates the risk of problem drinking via an internalizing/negative affect pathway involving right ventrolateral perfrontal cortex and reappraisal of negative emotion.
24465390 The receptors' binding specificity and structural studies were performed using full-length human CRFR1alpha and mouse CRFR2beta as well as fragments lacking the N-terminal extracellular domain.
24422887 The results of this study support a definite role for CRHR1 in the pharmacogenetics of antidepressant drugs.
24290358 A detailed conformational model for the CRF1R-Ucn1 complex based on the many ligand-receptor interactions determined was here and eventually revealed unique features of peptide ligand binding to class B GPCRs.
24243082 The present results, for the first time, indicate that the CRHR1 gene polymorphism is significantly associated with aggressive behavior in Chinese southwest Han population.
24099078 In a community-based longitudinal study of European Americans, polymorphisms of CRHR1 in the HPA axis were found to moderate the impact on adult survivors of child abuse and adult stressful events on physical health.
24077033 Studied the relationship between 12 SNPs in CRHR1 and post-disaster PTSD in adults exposed to 2004 Florida hurricanes.After correction for multiple testing, rs12938031 and rs4792887 remained associated with post-hurricane PTSD symptoms.
24075295 Carrying a CRHR1 rs1876831 C allele was associated with significantly more post-ICU depressive symptoms compared to T/T homozygotes
24012103 association between polymorphisms of CRHR1 gene and excitement and psychotic dimension. and CRHR1 gene in the etiology of psychotic features in affective disorders and possible involvement of CRHR1 gene in the etiology of bipolar disorder.
23982282 These results fail to provide support for an association of CRHR1 and CRHR2 with personality traits in a Japanese adult population.
23962971 Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders.
23933692 Data suggest that expression of CRF, CRF-related neuropeptides, and CRF receptors in the liver plays crucial regulatory roles in homeostasis, in allostasis to endogenous stresses, and in adaptation to exogenous stress stimuli. [REVIEW]
23933425 study provides the first evidence in humans that the CRHR1 gene interacts with exposure to a negative social environment to predict loneliness in older adults.
23863939 crystal structure of the transmembrane domain of the human corticotropin-releasing factor receptor type 1 in complex with the small-molecule antagonist CP-376395
23821771 Data indicate that estrogen increased the abundance of the mRNA encoding CRH-R2 and an alternative splice variant encoding CRH-R1 in which exon 12 was deleted [CRH-R1(Delta12)].
23726670 The rs242939 SNP of CRHR1 is associated with increased EPDS values during pregnancy.
23717480 The present results indicate that genetic variability in the corticotropin-releasing hormone receptor 1, especially in interaction with the 5HTTLPR, is involved in the acquisition of fear in humans.
23666959 CRH/CRHR1 are involved in regulation of PGHS2 (prostaglandin-endoperoxide synthase 2) expression in myometrium before/during labor; these actions appear important in priming myometrium for labor and adaptive responses to inflammatory mediators.
23644483 Postnatally stressed adult transgenic mice have decreased hippocampal nectin-3 levels, which could be attenuated by CRHR1 inactivation and mimicked by corticotropin-releasing hormone (CRH) overexpression in forebrain neurons.
23576434 studies show that SAP97 interactions with CRFR1 attenuate CRFR1 endocytosis and that SAP97 is involved in coupling G protein-coupled receptors to the activation of the ERK1/2 signaling pathway.
23529111 Data indicate the interaction of the corticotropin-releasing-hormone receptor 1 (CRHR1) gene and negative life events in recurrent major depressive disorder (MDD).
23473364 the study provides evidence of G x E effects implicating several CRHR1 SNPs and haplotypes with alcoholism risk in the context of traumatic stress exposure in adulthood.
23302658 CRF1 receptor activation during stress exposure protects against cognitive decline in transgenic Alzheimer's disease mice.
23274505 We show association of variants in FKBP5 and CRHR1 with cortisol response to psychosocial stress.
23239826 This review shows sex differences associated with CRF receptor (CRF)1 with Gs protein and beta-arrestin 2 rendering females more responsive to acute stress and less able to adapt to chronic stress as a result of compromised CRF1 internalization.
23177644 Polymorphisms within CRHR1 and CRHR2 genes interacted with both childhood sexual abuse and emotional neglect to influence Iowa Gambling Task performance
23131710 Significant main effects on children's cortisol reactivity were found for loci on CRHR1 and CRHBP. Haplotypes of the CRHR1 linkage region were also associated with cortisol reactivity
23068076 association was found for alleles, genotypes, or haplotype analysis for CRHR1 genes and melancholic depression.
22957021 genetic polymorphisms and the CRH-R1 haplotypes moderate irritable bowel syndrome (IBS) and related bowel patterns, but not negative emotion accompanying IBS
22948128 CRF1 is expressed along the gastrointestinal tract of healthy subjects with a prominent expression in the ileum and rectum. CRF1 is upregulated in the lamina propria cells of colonic mucosa in the ulcerative colitis patients.
22748421 CRHR1 gene and childhood adversity interact to predict depressive symtoms in young adults.
22573456 Genetic variants in CRHR1 that associate with differential cortisol activation may also modulate levels of anxiety related to the stress of raising a child with fragile X syndrome among women who carry an FMR1 premutation.
22467522 12 single nucleotide polymorphisms (SNPs) CRHR1 and CRHR2 in major depressive disorder patients (n = 173), panic disorder patients (n = 180), and healthy controls, were investigated.
22410078 CRHR1 variations are associated with reduced prefrontal activation during extinction in human fear conditioning.
22378896 CRHR1 single nucleotide polymorphism rs110402 moderates neural responses to emotional stimuli, suggesting a potential mechanism of vulnerability for the development of major depressive disorder.
22360979 decreased skin CRHR-1 gene expression in psoriasis and atopic dermatitis
22350180 increased expression in the skin of psoriasis patients is associated with disease severity
22341483 polymorphisms rs1293651 of CRHR1 gene may increase susceptibility for obtaining psychotic features in the course of bipolar disorder I.
22322595 Degradation by ECE-1 is a novel mechanism by which CRF(1) receptor is protected from overactivation by physiologically relevant high concentrations of higher affinity ligand to mediate distinct resensitization and downstream signaling.
22258127 Describe genetic associations between persistent pulmonary hypertension of the newborn and CRHR1.
22249355 In conclusion, CRHR1 variation merits investigation in pathophysiology of anxiety and its treatment response.
22247544 Both N- and C-terminal regions of the third intracellular loop of CRH-R1 contributed to ERK1/2 activation.
22234467 in placenta, CRH produced locally regulates GLUT1 and GLUT3 expression, CRHR1 and CRHR2-mediated differential regulation of GLUT1 and GLUT3 expression
22194899 An interaction between CRHR1 and BDNF genes constitutes susceptibility to recurrent major depressive disorder.
22018085 association of SNPs and child maltreatment on diurnal cortisol regulation and internalizing symptomatology
21998007 The complex structure of CRHR1 may help to explain why some variants in the gene moderate the effects of an Adverse childhood experiences only on depression risk while others moderate the effect of an ACE only on alcohol dependence risk.
21976528 The role for a CRF1-dependent mechanism is supported by the finding that mice overexpressing CRF have increased hyperphosphorylated tau compared with wild-type littermates.
21976504 MicroRNA-34c transgene reduces the responsiveness of cells to stress-related corticotropin releasing factor CRF in neuronal cells endogenously expressing CRFR1.
21917807 acute, uncontrollable stressors reduce participants' ability to modulate behavior as a function of reward, and such effects are modulated by CRHR1 genotype.
21843515 In this review commentary, the available evidence supporting the role of both CRF1 and CRF2 receptors in stress-induced relapse to drug seeking is reviewed.
21810631 interaction of SNP rs110402 and CRHBP rs3811939 predicts high risk of comorbid alcoholism in schizophrenic patients
21789663 CRHR1, FKBP5 and NR3C1 gene variants are not associated with offspring depression symptoms from mothers with recurrent depression
21752573 Of the potentially involved genes, CRH-R1 appears as a plausible candidate in the literature for link of between stress and alcohol use.
21605337 subjects who had attempted suicide were observed to differentially associate with two novel gene-environment interactions involving physical assault with different life timing and single nucleotide polymorphisms located in opposite ends of CRHR1.
21508513 the present study adds support for the role of corticotropin releasing hormone receptor 1 in the stress response following potentially traumatic event exposure in youth
21487655 data suggest a prominent role of CRF(1) in stressor-induced changes in EtOH consumption, with involvement of CRF(2) in recovery from stressor effects
21438878 Variation in CRHR1 moderates the association of maltreatment with neuroticism.
21123435 These findings define the expression of enterochromaffin cell-specific CRH(1) isoforms and activation of CRH(1)-dependent pathways leading to serotonin release and synthesis.
20957648 A single nucleotide polymorphism (rs17689882) in the corticotropin-releasing hormone receptor gene may connect childhood abuse and genetic susceptibility to adult depression.
20843795 complex formation between an agonist and the ECD1-CRF-R1 promotes the helical conformation of the N terminus of the former, important for receptor activation
20734064 Observational study of gene-disease association. (HuGE Navigator)
20702571 Novel evidence for distinct patterns of CRH-R1 splicing and identify specific steroid-mediated regulation of CRH-R1 variant expression, which might be important for modulating CRH actions during human pregnancy and labour.
20699326 Results from a combined meta-analysis of all 3967 MS cases and 8599 controls provide strong evidence for the involvement of CRHR1 in MS
20673868 Observational study of gene-disease association. (HuGE Navigator)
20630588 both CRF receptors were found in breast cancer and the respective benign adjacent tissue. The two CRF receptor proteins presented distinct distribution and subcellular localization, pointing into differing biological roles.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20594969 cross-talk between corticotropin-releasing factor (CRF) and muscarinic receptors
20468064 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20403506 Observational study of gene-disease association. (HuGE Navigator)
20374216 CRHR1 may be involved in modulating the P3 component of the ERP during information processing and in vulnerability to alcoholism.
20374216 Observational study of gene-disease association. (HuGE Navigator)
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20233629 observe direct NF-kappaB/p65 interaction within the promoter region and site-directed mutagenesis reveals that all three kappaB sites are required to mediate histamine and NF-kappaB/p65 regulation of CRH-R1 promoter activity.
20161813 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029939 The effects of child abuse are moderated by genetic variation at both the CRHR1 and 5-HTTLPR loci and by their Gene x Gene interaction.
20029939 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20010888 these findings, especially those related to variants within CRHR1, supports the preclinical and clinical data implicating the CRF system in the pathophysiology of depression and anxiety.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878140 CRHR1 and at least four other genes are located at 17q21.31 in an extremely large block of high linkage disequilibrium resulting from a local chromosomal inversion; the minor allele of rs1876831 is contained within the H2 haplotype.
19878140 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19844206 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19750552 Recently reported genetic association studies indicate that these effects may be mediated, in part, by genexenvironment interactions involving polymorphisms within two key genes, CRHR1 and FKBP5.
19736354 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19723618 Observational study of gene-disease association. (HuGE Navigator)
19697526 The results do not confirm the hypothesis that the analysed region of the CRHR 2 gene is involved in the pathogenesis of anorexia nervosa
19663668 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19607758 This study demonstrated that the CRHR1 gene and stressful life events interact to predict both drinking initiation in adolescence and progression of heavy alcohol. use in young adulthood.
19607758 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19596121 Variation in the CRHR1 moderates the effect of childhood maltreatment on cortisol responses to the DEX/CRH test. Excessive HPA axis activation could represent a mechanism of interactions of risk genes with stress.
19596121 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19548263 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19433256 CRH-R1 and CRH-R2 receptors and their endogenous ligands have a role in the biology of human endometrial cancer.
19432998 The protein level of CRH-R1 in upper segmentmyometrium was significantly down-regulated in pregnancy, with a further decrease at the onset of labour; the expression of CRH-R1 in lower segment remained unchanged during pregnancy and labour
19409922 genetic variations in CRF or CRF1 may confer a susceptibility to alcohol--REVIEW
19336370 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19220485 male suicidal offspring have increased depression intensity related to main genetic effects of exonic single nucleotide polymorphisms and homozygous non-CGC of CRHR1 gene haplotypes
19220485 Observational study of gene-disease association. (HuGE Navigator)
19210659 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124613 A specific region of the CRF1 receptor is identified by alanine scanning mutagenesis that is responsible for binding between the receptor and the amino-terminal peptides of the CRF family.
19098121 CRF1 and CRF2a receptors couple to different G-proteins in stably transfected human cells, leading to transient divalent calcium ion mobilization on top of the natural increase in cyclic AMP stimulation.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19081678 Observational study of gene-disease association. (HuGE Navigator)
19022385 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19006179 CRF1 may play an important role in the regulation of skin cell phenotype with potential implications in pathology.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18981346 2 independent samples to test for associations of corticotropin-releasing hormone receptor gene (CRHR1) polymorphisms with adult depressive symptoms following early child abuse.
18838498 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18801728 analysis of molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1
18772229 Site-directed mutagenesis studies identified the cassette G356-F358 within transmembrane domain 7 as crucial for CRH-R1alpha stability to the plasma membrane because deletion of this cassette caused substantial intracellular localization of CRH-R1 alpha.
18622266 Observational study of gene-disease association. (HuGE Navigator)
18565889 Three CRHR1 single nucleotide polymorphisms (SNPs), all in linkage disequilibrium, were associated with bone density in a sex-specific manner in ALL survivors.
18565889 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18539200 CRHR1 polymorphisms are not associated with immediate or long-term improvement in FEV1 by inhaled corticosteroids
18496130 Observational study of gene-disease association. (HuGE Navigator)
18452185 genes encoding corticotropin releasing hormone receptor 1, tachykinin receptor 1, gastrin releasing peptide, and gastrin releasing peptide receptor were selected as candidates for PD based on their biology
18452185 Observational study of gene-disease association. (HuGE Navigator)
18384079 polymorphisms in the AVPR1B and the CRHR1 genes alter the susceptibility to panic disorder
18384079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18325997 Cultured placental trophoblasts express both CRH-R1 and CRH-R2.
18250257 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18250257 To examine whether the effects of child abuse on adult depressive symptoms are moderated by genetic polymorphisms within the corticotropin-releasing hormone type 1 receptor (CRHR1) gene.
18239030 These findings imply that nonpeptide ligands differentially modulate conformational states involved in CRF(1) receptor activation.
17959885 Human myometrium expresses both CRH-R1 and CRH-R2 during pregnancy. A heterogeneous distribution of CRH-R1 variants in term labor and nonlabor myometrium might be related to the contractile phenotype of myometrium at term.
17913459 A penta-aminoacid cassette within the 29-aminoacid insert of CRH-R1beta contains multiple positive charged aminoacids, an important structural determinant for the impaired cAMP response and CRH-R1 coupling to Gs proteins.
17667919 Findings support the hypothesis that CRHR1 antagonists could potentially be used against ovarian cancer.
17597588 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17597588 Adolescents homozygous for the C allele of rs1876831 drank higher maximum amounts of alcohol per occasion and had greater lifetime rates of heavy drinking in relation to negative life events than individuals carrying the T allele.
17532191 Observational study of gene-disease association. (HuGE Navigator)
17463062 in chorion trophoblast cells, CRHR1 and CRHR2 mediate divergent effects on PGDH expression, and this may provide a precise regulation of PGs levels from chorion to myometrium during pregnancy
17376150 Stratification based on the levels of lifetime stress showed reproducible association and linkage of an SNP in the CRHR1 gene (rs4792887) to suicide attempters exposed to low levels of stress (P = 0.002), among whom most males were depressed.
17376150 Observational study of gene-disease association. (HuGE Navigator)
17330132 affected psoriatic skin has decreased gene expression of CRH-R1 mRNA than normal con
17318384 V1bR and CRHR1 can form constitutive homo- and heterodimers.
17294739 The elevated level of placental CRH may be a trigger of the transcription of its own receptor CRH-R1 during caesarian operations.
17258395 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17258395 The results support the idea that the CRHR1 gene is likely to be involved in the antidepressant response in MDD.
17170072 Both CRHR1 and CRHR2 play a facilitatory role in the non-clathrin-, non-caveolae-mediated endocytosis and intracellular signal transduction of urocortin.
17010515 our results do not support an involvement of CRHR1 gene in progressive supranuclear palsy pathogenesis
16959871 A complex signaling network appears to mediate CRH-R1alpha-MAPK interactions; PI3-K might play a critical role in the regulation of CRH-R1alpha signaling selectivity and cellular responses.
16906164 Deletion of CRHR1 is associated with a common inversion polymorphism.
16815632 Observational study of gene-disease association. (HuGE Navigator)
16734917 expression of CRH-BP, CRH-R1 and CRH-R2 in uterine tissues is down-regulated during pregnancy
16721033 adrenocortical cells exhibit a higher expression of functional CRH receptors than chromaffin cells and that CRH acts on adrenal DHEA production
16550213 Observational study of gene-disease association. (HuGE Navigator)
16550213 In adolescents, significant group differences between genotypes were observed in binge drinking and lifetime prevalences of alcohol intake and drunkenness. In adult alcohol-dependent patients, CRHR1 was associated with high amounts of drinking.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16412099 CRF1alpha receptor resensitization is regulated in an atypical manner by Rab GTPases.
16297195 Chronic urticaria expresses high levels of CRH-R1 as compared to normal foreskin, breast skin and cultured human keratinocytes.
16113459 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15992556 Observational study of gene-disease association. (HuGE Navigator)
15784708 Pregnancies with abnormal placental function such as preeclampsia are characterized by increased maternal plasma CRH concentrations and reduced placental CRH-receptor 1alpha.
15498832 the CRH-R1alpha carboxyl tail is important for regulation of receptor activity by G protein-coupled receptor kinase
15450949 phospholipase C-mediated signaling of CRF receptors is dependent upon the cellular background and that in HEK293 cells human CRF receptors robustly respond in the FLIPR format.
15365580 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15365580 Study found increased response to antidepressants in highly anxious patients homozygous for the GAG haplotype of CRH receptor 1.
15293277 Observational study of gene-disease association. (HuGE Navigator)
15252011 coupling of CRFR1 to different G proteins is regulated by concentrations of the stimulating ligand and GTP
15206947 characterization of isoforms and effect on cyclic AMP levels
15203442 Observational study of gene-disease association. (HuGE Navigator)
15192151 Cortagine, an agonist of CRF1, modulates depression and anxieety in c57bl mice in maze learning.
15128701 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15100165 This review notes findings that implicate CRF1 receptors in stress-related stimulation of colonic function and hypersensitivity to colorectal distention.
14764822 CRH-R1:CRH-R2 ratio varied according to fat-depot type; whereas CRH-R1 expression was higher in sc fat than in visceral fat, the opposite was true for CRH-R2.
14724656 Observational study of gene-disease association. (HuGE Navigator)
14657255 Ser(301), which is located in the third intracellular loop of CRHR1, is critical for efficient coupling of the receptor to G proteins and to second messenger generation.
12784189 Detected in placenta, myometrium, decidua, and fetal membranes. Widespread expression of CRH system in gestational tissue suggests paracrine role CRH in birth process (e.g. effects on macrophages and endothelial cells).
12519878 results showed that CRH-R1 alpha mRNA levels and protein levels were significantly reduced in preeclamptic and growth-restricted placentas
12504877 The binding of CRF to the type 1 receptor may be involved in regulating the development of cerebellar neurons and glia immediately after birth, before CRF assumes its function as a neuromodulator later in postnatal development and in the adult.
11861501 CRH inhibits cell growth of human endometrial adenocarcinoma cells via CRH-receptor 1-mediated activation of cAMP-PKA pathway

AA Sequence

MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPA      1 - 70
FFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVL     71 - 140
FLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVH    141 - 210
QSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKL    211 - 280
YYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP    281 - 350
LLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV    351 - 420
ARAMSIPTSPTRVSFHSIKQSTAV                                                  421 - 444
//

Text Mined References (230)

PMID Year Title
26940669 2016 Hsa-miR-34a mediated repression of corticotrophin releasing hormone receptor 1 regulates pro-opiomelanocortin expression in patients with complex regional pain syndrome.
26206446 2015 Family Economic Hardship, Corticotropin-Releasing Hormone Receptor Polymorphisms, and Depressive Symptoms in Rural African-American Youths.
26115868 2015 Role of cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) in regulating the trafficking and signaling of corticotropin-releasing factor receptor 1.
25960164 2015 The activation of type 1 corticotropin releasing factor receptor (CRF-R1) inhibits proliferation and promotes differentiation of neuroblastoma cells in vitro via p27(Kip1) protein up-regulation and c-Myc mRNA down-regulation.
25954915 2015 Association analysis of polymorphisms of the CRHR1 gene with infantile spasms.
25802844 2015 Ethnic-specific genetic association of variants in the corticotropin-releasing hormone receptor 1 gene with nicotine dependence.
25712009 2015 CRHR1 Gene SNPs and Response to Systemic Corticosteroids in Indian Asthmatic Children During Acute Exacerbation.
25648046 2016 Influence of maternal depression on children's brooding rumination: Moderation by CRHR1 TAT haplotype.
25640828 2015 Genetic moderation of interpersonal psychotherapy efficacy for low-income mothers with major depressive disorder: implications for differential susceptibility.
25630718 2015 Inhibiting interleukin-18 production through the mitogen-activated protein kinase pathway, a potential role of corticotropin-releasing hormone in chronic plaque psoriasis.
25575243 2015 Cell type-specific modifications of corticotropin-releasing factor (CRF) and its type 1 receptor (CRF1) on startle behavior and sensorimotor gating.
25556110 2015 Corticotropin-releasing factor 1 receptor mediates the activity of the reward system evoked by morphine-induced conditioned place preference.
25541005 2015 Variation in the corticotropin-releasing hormone receptor 1 (CRHR1) gene modulates age effects on working memory.
25473847 2014 Galectin-1 overexpression in endometriosis and its regulation by neuropeptides (CRH, UCN) indicating its important role in reproduction and inflammation.
25422958 2014 Sensitizing effect of early adversity on depressive reactions to later proximal stress: Moderation by polymorphisms in serotonin transporter and corticotropin releasing hormone receptor genes in a 20-year longitudinal study.
25422957 2014 Genetic moderation of child maltreatment effects on depression and internalizing symptoms by serotonin transporter linked polymorphic region (5-HTTLPR), brain-derived neurotrophic factor (BDNF), norepinephrine transporter (NET), and corticotropin releasing hormone receptor 1 (CRHR1) genes in African American children.
25254562 2014 Immunolocalization of corticotropin-releasing hormone (CRH) and its receptors (CRHR1 and CRHR2) in human endometrial carcinoma: CRHR1 as a potent prognostic factor.
25015995 2014 The role of corticotropin-releasing hormone receptor 1 in the development of colitis-associated cancer in mouse model.
24985398 2014 High serum corticotropin-releasing hormone (CRH) and bone marrow mast cell CRH receptor expression in a mastocytosis patient.
24966326 2014 The specific monomer/dimer equilibrium of the corticotropin-releasing factor receptor type 1 is established in the endoplasmic reticulum.
24931706 2014 Interaction of early life stress and corticotropin-releasing hormone receptor gene: effects on working memory.
24838244 2014 Structural-functional analysis of the third transmembrane domain of the corticotropin-releasing factor type 1 receptor: role in activation and allosteric antagonism.
24741566 2014 Genetic variants in the genes of the stress hormone signalling pathway and depressive symptoms during and after pregnancy.
24703172 2014 CRHR1 genotype and history of maltreatment predict cortisol reactivity to stress in adolescents.
24687410 2014 CRF1 receptor-deficiency induces anxiety-like vulnerability to cocaine.
24630468 2014 CRHR1 links peripuberty stress with deficits in social and stress-coping behaviors.
24623788 2014 Indirect effect of corticotropin-releasing hormone receptor 1 gene variation on negative emotionality and alcohol use via right ventrolateral prefrontal cortex.
24465390 2014 Expression and functional characterization of membrane-integrated mammalian corticotropin releasing factor receptors 1 and 2 in Escherichia coli.
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24422887 2014 Influence of genetic polymorphisms involved in the hypothalamic-pituitary-adrenal axis and their interactions with environmental factors on antidepressant response.
24290358 2013 Genetically encoded chemical probes in cells reveal the binding path of urocortin-I to CRF class B GPCR.
24243082 2014 The CRHR1 gene contributes to genetic susceptibility of aggressive behavior towards others in Chinese southwest Han population.
24099078 2014 FKBP5 and CRHR1 polymorphisms moderate the stress-physical health association in a national sample.
24077033 2013 Association of CRHR1 variants and posttraumatic stress symptoms in hurricane exposed adults.
24075295 2014 A pilot investigation of the association of genetic polymorphisms regulating corticotrophin-releasing hormone with posttraumatic stress and depressive symptoms in medical-surgical intensive care unit survivors.
24012103 2013 Association between OPCRIT dimensions and polymorphisms of HPA axis genes in bipolar disorder.
23982282 2013 Association between corticotropin-releasing hormone receptor 1 and 2 (CRHR1 and CRHR2) gene polymorphisms and personality traits.
23962971 2013 Epistatic interaction between CRHR1 and AVPR1b variants as a predictor of major depressive disorder.
23933692 The corticotropin releasing factor system in the liver: expression, actions and possible implications in hepatic physiology and pathology.
23933425 2014 Influence of social environment on loneliness in older adults: Moderation by polymorphism in the CRHR1.
23863939 2013 Structure of class B GPCR corticotropin-releasing factor receptor 1.
23821771 2013 Estrogen alters the splicing of type 1 corticotropin-releasing hormone receptor in breast cancer cells.
23726670 2013 Association of glucocorticoid and type 1 corticotropin-releasing hormone receptors gene variants and risk for depression during pregnancy and post-partum.
23717480 2013 Human fear acquisition deficits in relation to genetic variants of the corticotropin releasing hormone receptor 1 and the serotonin transporter.
23666959 2013 Corticotropin-releasing hormone interacts with interleukin-1? to regulate prostaglandin H synthase-2 expression in human myometrium during pregnancy and labor.
23644483 2013 Nectin-3 links CRHR1 signaling to stress-induced memory deficits and spine loss.
23576434 2013 Role of SAP97 protein in the regulation of corticotropin-releasing factor receptor 1 endocytosis and extracellular signal-regulated kinase 1/2 signaling.
23529111 2013 Negative life events and corticotropin-releasing-hormone receptor1 gene in recurrent major depressive disorder.
23473364 2013 The CRHR1 gene, trauma exposure, and alcoholism risk: a test of G × E effects.
23302658 2013 Corticotropin-releasing factor receptor 1 activation during exposure to novelty stress protects against Alzheimer's disease-like cognitive decline in A?PP/PS1 mice.
23274505 2013 Genetic association of FKBP5 and CRHR1 with cortisol response to acute psychosocial stress in healthy adults.
23239826 2013 Sex-biased stress signaling: the corticotropin-releasing factor receptor as a model.
23177644 2013 HPA axis genes may modulate the effect of childhood adversities on decision-making in suicide attempters.
23131710 2013 Corticotropin-releasing hormone system polymorphisms are associated with children's cortisol reactivity.
23068076 2013 No association between polymorphisms and haplotypes of the AVPR1b, CRHR1 and NR3C1 genes and depression with melancholic features in the course of bipolar disorder.
22957021 2012 Corticotropin-releasing hormone receptor 1 gene variants in irritable bowel syndrome.
22948128 2012 Expression of corticotropin releasing factor receptor type 1 (CRF1) in the human gastrointestinal tract and upregulation in the colonic mucosa in patients with ulcerative colitis.
22748421 2013 Interactive effects of corticotropin-releasing hormone receptor 1 gene and childhood adversity on depressive symptoms in young adults: findings from a longitudinal study.
22573456 2012 Depression and anxiety symptoms among women who carry the FMR1 premutation: impact of raising a child with fragile X syndrome is moderated by CRHR1 polymorphisms.
22504419 2012 Common variants at 12q15 and 12q24 are associated with infant head circumference.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22467522 2012 Association of CRHR1 and CRHR2 with major depressive disorder and panic disorder in a Japanese population.
22410078 2012 Brain activation during fear conditioning in humans depends on genetic variations related to functioning of the hypothalamic-pituitary-adrenal axis: first evidence from two independent subsamples.
22378896 2012 Variation in the corticotropin-releasing hormone receptor 1 (CRHR1) gene influences fMRI signal responses during emotional stimulus processing.
22360979 2012 Increased serum CRH levels with decreased skin CRHR-1 gene expression in psoriasis and atopic dermatitis.
22350180 2012 The association of PASI scores with CRH-R1 expression in patients with psoriasis.
22341483 2012 Association between functional polymorphism of the AVPR1b gene and polymorphism rs1293651 of the CRHR1 gene and bipolar disorder with psychotic features.
22322595 2012 Endothelin-converting enzyme-1 actions determine differential trafficking and signaling of corticotropin-releasing factor receptor 1 at high agonist concentrations.
22258127 2012 Variations in CRHR1 are associated with persistent pulmonary hypertension of the newborn.
22249355 2013 Pharmacogenetic investigation of response to duloxetine treatment in generalized anxiety disorder.
22247544 2012 Mapping structural determinants within third intracellular loop that direct signaling specificity of type 1 corticotropin-releasing hormone receptor.
22234467 2012 Differential regulation of glucose transporters mediated by CRH receptor type 1 and type 2 in human placental trophoblasts.
22194899 2011 Interaction between CRHR1 and BDNF genes increases the risk of recurrent major depressive disorder in Chinese population.
22018085 2011 Interactive effects of corticotropin releasing hormone receptor 1, serotonin transporter linked polymorphic region, and child maltreatment on diurnal cortisol regulation and internalizing symptomatology.
21998007 2011 A CRHR1 haplotype moderates the effect of adverse childhood experiences on lifetime risk of major depressive episode in African-American women.
21976528 2011 Chronic stress exacerbates tau pathology, neurodegeneration, and cognitive performance through a corticotropin-releasing factor receptor-dependent mechanism in a transgenic mouse model of tauopathy.
21976504 2011 MicroRNA as repressors of stress-induced anxiety: the case of amygdalar miR-34.
21917807 2011 Corticotropin-releasing hormone receptor type 1 (CRHR1) genetic variation and stress interact to influence reward learning.
21843515 2012 Relevance of both type-1 and type-2 corticotropin releasing factor receptors in stress-induced relapse to cocaine seeking behaviour.
21810631 2011 Prediction of the risk of comorbid alcoholism in schizophrenia by interaction of common genetic variants in the corticotropin-releasing factor system.
21789663 2012 Maternal depression and child and adolescent depression symptoms: an exploratory test for moderation by CRHR1, FKBP5 and NR3C1 gene variants.
21752573 2012 [The role of genetic factors on the link between stress and alcohol use: the example of CRH-R1].
21605337 2011 Gene-environment interactions between CRHR1 variants and physical assault in suicide attempts.
21508513 2011 Corticotrophin-releasing hormone type 1 receptor gene (CRHR1) variants predict posttraumatic stress disorder onset and course in pediatric injury patients.
21487655 2011 Ethanol concentration-dependent effects and the role of stress on ethanol drinking in corticotropin-releasing factor type 1 and double type 1 and 2 receptor knockout mice.
21438878 2011 Moderation of the association between childhood maltreatment and neuroticism by the corticotropin-releasing hormone receptor 1 gene.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21123435 2011 Activation of Type 1 CRH receptor isoforms induces serotonin release from human carcinoid BON-1N cells: an enterochromaffin cell model.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20957648 2010 Childhood maltreatment, the corticotropin-releasing hormone receptor gene and adult depression in the general population.
20843795 2010 NMR structure of the first extracellular domain of corticotropin-releasing factor receptor 1 (ECD1-CRF-R1) complexed with a high affinity agonist.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20702571 2010 Identification of a novel corticotropin-releasing hormone type 1beta-like receptor variant lacking Exon 13 in human pregnant myometrium regulated by estradiol-17beta and progesterone.
20699326 2010 Evidence for CRHR1 in multiple sclerosis using supervised machine learning and meta-analysis in 12,566 individuals.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20630588 2010 Distinct distribution of corticotropin releasing factor receptors in human breast cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20594969 2010 Corticotropin-releasing factor receptors induce calcium mobilization through cross-talk with Gq-coupled receptors.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20403506 2010 Genetic variation in neuroendocrine genes associates with somatic symptoms in the general population: results from the EPIFUND study.
20374216 2010 Single-nucleotide polymorphisms in corticotropin releasing hormone receptor 1 gene (CRHR1) are associated with quantitative trait of event-related potential and alcohol dependence.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20233629 2010 Histamine modulation of peripheral CRH receptor type 1alpha expression is dependent on Ca(2+) signalling and NF-kappaB/p65 transcriptional activity.
20161813 2009 Effect of Childhood Trauma on Adult Depression and Neuroendocrine Function: Sex-Specific Moderation by CRH Receptor 1 Gene.
20029939 2010 Polymorphisms in CRHR1 and the serotonin transporter loci: gene x gene x environment interactions on depressive symptoms.
20010888 2010 The CRF system, stress, depression and anxiety-insights from human genetic studies.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878140 2010 H2 haplotype at chromosome 17q21.31 protects against childhood sexual abuse-associated risk for alcohol consumption and dependence.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19844206 2009 Sequence variations of ABCB1, SLC6A2, SLC6A3, SLC6A4, CREB1, CRHR1 and NTRK2: association with major depression and antidepressant response in Mexican-Americans.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19750552 2009 Risk and resilience: genetic and environmental influences on development of the stress response.
19736354 2009 Protective effect of CRHR1 gene variants on the development of adult depression following childhood maltreatment: replication and extension.
19723618 2010 Genetic variation in the hypothalamic-pituitary-adrenal stress axis influences susceptibility to musculoskeletal pain: results from the EPIFUND study.
19697526 [Molecular analysis of the corticotropin-releasing hormone receptor type 2 gene fragment in anorexia nervosa].
19663668 2009 Predictors of poor response during asthma therapy differ with definition of outcome.
19607758 2010 Interacting effects of CRHR1 gene and stressful life events on drinking initiation and progression among 19-year-olds.
19596121 2009 Interaction of childhood maltreatment with the corticotropin-releasing hormone receptor gene: effects on hypothalamic-pituitary-adrenal axis reactivity.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19433256 2009 Expression and subcellular localization of CRH and its receptors in human endometrial cancer.
19432998 2009 Reduced expression of CRH receptor type 1 in upper segment human myometrium during labour.
19409922 2009 Gene-environment interactions resulting in risk alcohol drinking behaviour are mediated by CRF and CRF1.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19220485 2009 Depression in suicidal males: genetic risk variants in the CRHR1 gene.
19210659 2009 Association between CRHR1 polymorphism and improved lung function in response to inhaled corticosteroid in patients with COPD.
19131402 2009 Predicting risk of bacterial vaginosis: the role of race, smoking and corticotropin-releasing hormone-related genes.
19124613 2009 Alanine scanning mutagenesis of the second extracellular loop of type 1 corticotropin-releasing factor receptor revealed residues critical for peptide binding.
19098121 2009 Molecular mechanisms of corticotropin-releasing factor receptor-induced calcium signaling.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19081678 2009 An angiotensin-1 converting enzyme polymorphism is associated with allostatic load mediated by C-reactive protein, interleukin-6 and cortisol.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19022385 2009 5'-Upstream variants of CRHR1 and MAPT genes associated with age at onset in progressive supranuclear palsy and cortical basal degeneration.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19006179 2009 CRF1 receptor splicing in epidermal keratinocytes: potential biological role and environmental regulations.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18981346 2008 Child abuse and adult major depression: no evidence of protective gene.
18838498 2010 Association of HPA axis genes with suicidal behaviour in schizophrenia.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18801728 2008 Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1.
18772229 2008 Structural determinants critical for localization and signaling within the seventh transmembrane domain of the type 1 corticotropin releasing hormone receptor: lessons from the receptor variant R1d.
18622266 2008 Chromosome 17: association of a large inversion polymorphism with corticosteroid response in asthma.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18565889 2008 CRHR1 polymorphisms predict bone density in survivors of acute lymphoblastic leukemia.
18539200 2008 Pharmacogenomics and outcome of asthma: no clinical application for long-term steroid effects by CRHR1 polymorphisms.
18496130 2008 Genetic predictors of glucocorticoid-induced hypertension in children with acute lymphoblastic leukemia.
18452185 2009 Association and linkage analysis of candidate genes GRP, GRPR, CRHR1, and TACR1 in panic disorder.
18384079 2008 Combined effects of exonic polymorphisms in CRHR1 and AVPR1B genes in a case/control study for panic disorder.
18325997 2008 Differential regulation of prostaglandin production mediated by corticotropin-releasing hormone receptor type 1 and type 2 in cultured human placental trophoblasts.
18292205 2008 Activation of corticotropin-releasing factor receptor 1 selectively inhibits CaV3.2 T-type calcium channels.
18250257 2008 Influence of child abuse on adult depression: moderation by the corticotropin-releasing hormone receptor gene.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18239030 2008 Allosteric ligands for the corticotropin releasing factor type 1 receptor modulate conformational states involved in receptor activation.
17959885 2007 Expression of corticotropin-releasing hormone receptor type 1 and type 2 in human pregnant myometrium.
17913459 2008 Structural domains determining signalling characteristics of the CRH-receptor type 1 variant R1beta and response to PKC phosphorylation.
17667919 2007 Intratumoral CRH modulates immuno-escape of ovarian cancer cells through FasL regulation.
17597588 2008 Interaction between CRHR1 gene and stressful life events predicts adolescent heavy alcohol use.
17532191 2007 Association study between the corticotropin-releasing hormone receptor 2 gene and suicidality in bipolar disorder.
17463062 2007 Corticotropin-releasing hormone receptor type 1 and type 2 mediate differential effects on 15-hydroxy prostaglandin dehydrogenase expression in cultured human chorion trophoblasts.
17376150 2008 The CRHR1 gene: a marker for suicidality in depressed males exposed to low stress.
17330132 2007 Skin corticotropin-releasing hormone receptor expression in psoriasis.
17318384 2007 Dimerization between vasopressin V1b and corticotropin releasing hormone type 1 receptors.
17294739 2007 [Action of corticotropin-releasing hormone on its own receptor type-1 in human placenta].
17258395 2007 Association study of corticotropin-releasing hormone receptor1 gene polymorphisms and antidepressant response in major depressive disorders.
17170072 2007 Corticotropin-releasing hormone receptor (CRHR)1 and CRHR2 are both trafficking and signaling receptors for urocortin.
17047935 2006 Dissociation between opioid and CRF1 antagonist sensitive drinking in Sardinian alcohol-preferring rats.
17015825 2006 Variation at the rat Crhr1 locus and sensitivity to relapse into alcohol seeking induced by environmental stress.
17010515 2006 No evidence of CRHR1 gene involvement in progressive supranuclear palsy.
16959871 2006 Identification of signaling molecules mediating corticotropin-releasing hormone-R1alpha-mitogen-activated protein kinase (MAPK) interactions: the critical role of phosphatidylinositol 3-kinase in regulating ERK1/2 but not p38 MAPK activation.
16906164 2006 A new chromosome 17q21.31 microdeletion syndrome associated with a common inversion polymorphism.
16815632 2006 Association of corticotropin-releasing hormone receptor1 gene SNP and haplotype with major depression.
16734917 2006 Corticotropin-releasing hormone, its binding protein and receptors in human cervical tissue at preterm and term labor in comparison to non-pregnant state.
16721033 2005 Corticotropin-releasing hormone receptor expression on normal and tumorous human adrenocortical cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16550213 2006 Genetic association of the human corticotropin releasing hormone receptor 1 (CRHR1) with binge drinking and alcohol intake patterns in two independent samples.
16484629 2006 The molecular mechanisms underlying the regulation of the biological activity of corticotropin-releasing hormone receptors: implications for physiology and pathophysiology.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16412099 2006 Differential regulation of corticotropin releasing factor 1alpha receptor endocytosis and trafficking by beta-arrestins and Rab GTPases.
16297195 2005 Corticotropin-releasing hormone receptor-1 and histidine decarboxylase expression in chronic urticaria.
16113459 2004 Asthma steroid pharmacogenetics: a study strategy to identify replicated treatment responses.
15992556 2005 Lack of association between single nucleotide polymorphisms in the corticotropin releasing hormone receptor 1 (CRHR1) gene and alcohol dependence.
15784708 2005 Preeclampsia is associated with impaired regulation of the placental nitric oxide-cyclic guanosine monophosphate pathway by corticotropin-releasing hormone (CRH) and CRH-related peptides.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
15498832 2005 Regulation of corticotropin-releasing hormone receptor type 1alpha signaling: structural determinants for G protein-coupled receptor kinase-mediated phosphorylation and agonist-mediated desensitization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450949 2004 Cell-type specific calcium signaling by corticotropin-releasing factor type 1 (CRF1) and 2a (CRF2(a)) receptors: phospholipase C-mediated responses in human embryonic kidney 293 but not SK-N-MC neuroblastoma cells.
15365580 2004 Association of a corticotropin-releasing hormone receptor 1 haplotype and antidepressant treatment response in Mexican-Americans.
15293277 2004 Novel haplotypes in 17q21 are associated with progressive supranuclear palsy.
15252011 2004 Regulation of the coupling to different G proteins of rat corticotropin-releasing factor receptor type 1 in human embryonic kidney 293 cells.
15206947 2004 Molecular and functional characterization of novel CRFR1 isoforms from the skin.
15203442 2004 No association of CRH1 receptor polymorphism haplotypes, harm avoidance and other personality dimensions in alcohol dependence: results from the Munich gene bank project for alcoholism.
15192151 2004 Cortagine, a specific agonist of corticotropin-releasing factor receptor subtype 1, is anxiogenic and antidepressive in the mouse model.
15142984 2004 Promoter analysis of human corticotropin-releasing factor (CRF) type 1 receptor and regulation by CRF and urocortin.
15128701 2004 Corticosteroid pharmacogenetics: association of sequence variants in CRHR1 with improved lung function in asthmatics treated with inhaled corticosteroids.
15100165 2004 CRF1 receptor signaling pathways are involved in stress-related alterations of colonic function and viscerosensitivity: implications for irritable bowel syndrome.
14764822 2004 Corticotropin-releasing hormone system in human adipose tissue.
14724656 2004 Genetic variation in the corticotrophin-releasing factor receptors: identification of single-nucleotide polymorphisms and association studies with obesity in UK Caucasians.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14657255 2004 Protein kinase A-induced negative regulation of the corticotropin-releasing hormone R1alpha receptor-extracellularly regulated kinase signal transduction pathway: the critical role of Ser301 for signaling switch and selectivity.
12784189 2003 Expression patterns of CRH, CRH receptors, and CRH binding protein in human gestational tissue at term.
12519878 2003 Reduced expression of corticotropin-releasing hormone receptor type-1 alpha in human preeclamptic and growth-restricted placentas.
12504877 2002 The distribution and cellular localization of CRF-R1 in the vermis of the postnatal mouse cerebellum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11606483 2001 Alternative splicing of CRH-R1 receptors in human and mouse skin: identification of new variants and their differential expression.
11425856 2001 Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
10598591 1999 A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes.
9757017 1998 The genomic organization of the human corticotropin-releasing factor type-1 receptor.
9661640 1998 Human corticotropin-releasing hormone receptor: differences in subtype expression between pregnant and nonpregnant myometria.
9423932 1997 Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin.
9253360 1997 Expression of genes encoding corticotropin-releasing factor (CRF), type 1 CRF receptor, and CRF-binding protein and localization of the gene products in the human ovary.
9178757 1997 Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8612563 1996 Cloning and characterization of human urocortin.
8243652 1993 Primary structure and functional expression of mouse pituitary and human brain corticotrophin releasing factor receptors.
7916328 1994 The human MCP-3 gene (SCYA7): cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12.
7811272 1994 A variant of the human corticotropin-releasing factor (CRF) receptor: cloning, expression and pharmacology.
7692441 1993 Expression cloning of a human corticotropin-releasing-factor receptor.
7590738 1995 The human corticotropin-releasing factor receptor (CRHR) gene maps to chromosome 17q12-q22.
7585095 1995 A placental clock controlling the length of human pregnancy.