Property Summary

NCBI Gene PubMed Count 53
PubMed Score 109.02
PubTator Score 82.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.400 6.8e-03
adrenocortical carcinoma -1.893 1.6e-06
astrocytic glioma -1.900 1.1e-02
Astrocytoma, Pilocytic -2.000 2.6e-04
ductal carcinoma in situ -1.300 4.9e-03
ependymoma -2.400 1.6e-03
fibroadenoma -1.100 4.0e-02
glioblastoma -1.300 2.4e-02
group 4 medulloblastoma -1.800 1.8e-02
invasive ductal carcinoma -1.400 2.0e-02
nephrosclerosis 1.464 1.9e-03
oligodendroglioma -2.200 1.2e-03
osteosarcoma -1.955 9.7e-04
pancreatic ductal adenocarcinoma liver m... -2.658 6.6e-04
pediatric high grade glioma -1.600 4.2e-03
Pick disease -1.300 7.2e-04

Gene RIF (43)

AA Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF      1 - 70
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF     71 - 140
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII    141 - 210
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT    211 - 280
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL                                281 - 322
//

Text Mined References (53)

PMID Year Title