Property Summary

NCBI Gene PubMed Count 51
PubMed Score 104.99
PubTator Score 82.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.464 1.9e-03
astrocytic glioma -1.900 1.1e-02
ependymoma -2.400 1.6e-03
oligodendroglioma -2.200 1.2e-03
glioblastoma -2.100 2.0e-04
osteosarcoma -1.955 9.7e-04
medulloblastoma -2.200 2.4e-05
adrenocortical carcinoma -1.893 1.6e-06
pancreatic ductal adenocarcinoma liver m... -2.658 6.6e-04
fibroadenoma -1.100 4.0e-02
pediatric high grade glioma -1.600 4.2e-03
pilocytic astrocytoma -2.000 2.6e-04
Pick disease -1.300 7.2e-04
ductal carcinoma in situ -1.300 4.9e-03
invasive ductal carcinoma -1.400 2.0e-02
acute myeloid leukemia -1.400 6.8e-03

Synonym

Accession P24387 Q53F32 Q6FHT5 CRF-BP
Symbols CRFBP
CRF-BP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
588473 screening 1622 / 0 / 347546 uHTS identification of agonists of the CRF-binding protein and CRF-R2 receptor complex
588475 screening 2056 / 0 / 347112 uHTS identification of antagonists of the CRF-binding protein and CRF-R2 receptor complex
588476 summary 0 / 0 / 0 Summary assay for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex
588491 summary 0 / 0 / 0 Summary assay for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex
602180 confirmatory 408 / 0 / 1320 Dose Response confirmation of uHTS hits for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex
602473 confirmatory 482 / 0 / 1938 Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex
651639 confirmatory 180 / 0 / 193 Dose Response confirmation of uHTS hits for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format
651648 confirmatory 35 / 0 / 58 SAR analysis of small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format
651649 confirmatory 20 / 0 / 8 SAR analysis of small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format

Gene RIF (41)

PMID Text
26882083 These results suggest that the CRH and CRH-BP genes have no direct effect on Irritable bowel syndrome status.
26447706 Genetic polymorphism rs7718461 in the CRHBP gene showed significant association with overall pain severity during the year after motor vehicle collision.
24075295 Homozygosity for the CRHBP rs10055255 T allele was associated with significantly fewer post-ICU PTSD and depressive symptoms
23131710 Significant main effects on children's cortisol reactivity were found for loci on CRHR1 and CRHBP.
22984453 A significant association was observed in Blacks, Hispanics and Whites between birth weight and maternal CRH-BP single nucleotide polymorphism genotypes.
22286724 There was a significant association between the s/s homozygous genotype for the 5-HTTLPR polymorphism of SLC6A4 gene and restrained eating condition (p = 0.033
21978546 CRHBP variation may predispose, independently and additively, to suicidal behavior in individuals who have experienced childhood trauma.
21810631 interaction of CRHR1 SNP rs110402 and SNP rs3811939 predicts high risk of comorbid alcoholism in schizophrenic patients
21039637 results extend recent preclinical and clinical findings implicating the CRH-BP in stress-related alcoholism and confirm the role of the Asp40 allele of the OPRM1 gene in reward-driven alcohol phenotypes
21039637 Observational study of gene-disease association. (HuGE Navigator)
20403506 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20368512 SNP rs10473984 affects response to citalopram in African American and Hispanic patients with major depressive disorder
20351714 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19723618 Observational study of gene-disease association. (HuGE Navigator)
19578876 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19131402 In white women, non-smokers with the CT genotype at CRH-BP + 17487 have lower Nugent scores than non-smokers with the TT genotype; whereas smokers with the CT genotype have higher Nugent scores than smokers with the TT genotype
19131402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18974851 CRH-BP modulates CRH which influences cortical and hippocampal EEG activity and is the primary mediator of the neuroendocrine stress response. this suggest a likely role for CRH-BP in stress-related alcoholism.
18974851 Observational study of gene-disease association. (HuGE Navigator)
18838498 genotype analyses yielded significant association between CRHBP and suicide attempt (P = 0.035); interaction analysis showed significant interaction between CRH receptor type 1 and CRHBP in influencing suicide attempt and severity of suicidal behaviour
18838498 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18234674 CRF-BP has distinct and separable binding surfaces for CRF and Ucn 1
17728670 Observational study of gene-disease association. (HuGE Navigator)
17728670 An isolated Swedish population does not support a role for the CRF-BP gene in the vulnerability for bipolar disorder.
17599466 Observational study of gene-disease association. (HuGE Navigator)
17599466 Five single nucleotide polymorphisms (SNPs) and a deletion polymorphism in the CRF-BP gene were genotyped and the haplotype block structure of the gene was assessed.
16734917 expression of CRH-BP, CRH-R1 and CRH-R2 in uterine tissues is down-regulated during pregnancy; the most pronounced down-regulation of CRH-BP and CRH-R2 occurred in laboring cervix, irrespective the length of gestation
16482088 We found a significant decrease in CRF-BP mRNA levels in the basolateral amygdala of male bipolar and male schizophrenic subjects and the lateral amygdala of male bipolar subjects compared to controls.
16368564 analysis of regulation and function of CRH-BP [review]
15072543 The placenta was identified as the main site of the CRH-BP mRNA expression during the last weeks of pregnancy
14573312 The corticotropin releasing hormone binding protein gene is likely to be involved in the genetic vulnerability for major depression.
12784189 Detected in myometrium. Widespread expression of CRH system in gestational tissue suggests paracrine role CRH in birth process (e.g. effects on macrophages and endothelial cells).

AA Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF      1 - 70
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF     71 - 140
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII    141 - 210
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT    211 - 280
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL                                281 - 322
//

Text Mined References (51)

PMID Year Title
26882083 2016 Associations between Single-Nucleotide Polymorphisms in Corticotropin-Releasing Hormone-Related Genes and Irritable Bowel Syndrome.
26447706 2016 CRHBP polymorphisms predict chronic pain development following motor vehicle collision.
24075295 2014 A pilot investigation of the association of genetic polymorphisms regulating corticotrophin-releasing hormone with posttraumatic stress and depressive symptoms in medical-surgical intensive care unit survivors.
23131710 2013 Corticotropin-releasing hormone system polymorphisms are associated with children's cortisol reactivity.
22984453 2012 Variation in the maternal corticotrophin releasing hormone-binding protein (CRH-BP) gene and birth weight in Blacks, Hispanics and Whites.
22286724 2011 [CRF-BP and SLC6A4 gene polymorphisms among restrained eaters].
21978546 2012 Two HPA axis genes, CRHBP and FKBP5, interact with childhood trauma to increase the risk for suicidal behavior.
21810631 2011 Prediction of the risk of comorbid alcoholism in schizophrenia by interaction of common genetic variants in the corticotropin-releasing factor system.
21624661 2011 Corticotropin-releasing factor binding protein enters the regulated secretory pathway in neuroendocrine cells and cortical neurons.
21039637 2011 Stress-induced and cue-induced craving for alcohol in heavy drinkers: Preliminary evidence of genetic moderation by the OPRM1 and CRH-BP genes.
20403506 2010 Genetic variation in neuroendocrine genes associates with somatic symptoms in the general population: results from the EPIFUND study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19723618 2010 Genetic variation in the hypothalamic-pituitary-adrenal stress axis influences susceptibility to musculoskeletal pain: results from the EPIFUND study.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19131402 2009 Predicting risk of bacterial vaginosis: the role of race, smoking and corticotropin-releasing hormone-related genes.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18974851 2008 Common genetic origins for EEG, alcoholism and anxiety: the role of CRH-BP.
18838498 2010 Association of HPA axis genes with suicidal behaviour in schizophrenia.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18559919 2008 Amniotic fluid and umbilical cord plasma corticotropin-releasing factor (CRF), CRF-binding protein, adrenocorticotropin, and cortisol concentrations in intraamniotic infection and inflammation at term.
18234674 2008 Residues of corticotropin releasing factor-binding protein (CRF-BP) that selectively abrogate binding to CRF but not to urocortin 1.
17728670 2007 Single nucleotide polymorphism analysis of corticotropin-releasing factor-binding protein gene in bipolar disorder.
17599466 2007 Single nucleotide polymorphism analysis of corticotropin-releasing factor-binding protein gene in recurrent major depressive disorder.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16734917 2006 Corticotropin-releasing hormone, its binding protein and receptors in human cervical tissue at preterm and term labor in comparison to non-pregnant state.
16482088 2006 Decreased amygdala CRF-binding protein mRNA in post-mortem tissue from male but not female bipolar and schizophrenic subjects.
16368564 2006 CRH-BP: the regulation and function of a phylogenetically conserved binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345745 2004 Estrogen receptor (ER)-mediated transcriptional regulation of the human corticotropin-releasing hormone-binding protein promoter: differential effects of ERalpha and ERbeta.
15072543 2004 mRNA expression profiles for corticotrophin-releasing hormone, urocortin, CRH-binding protein and CRH receptors in human term gestational tissues determined by real-time quantitative RT-PCR.
14573312 2003 The corticotropin-releasing hormone binding protein is associated with major depression in a population from Northern Sweden.
13150566 1954 Klebsiella pneumonia treated with tetracycline (achromycin): a case presentation.
12784189 2003 Expression patterns of CRH, CRH receptors, and CRH binding protein in human gestational tissue at term.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9253360 1997 Expression of genes encoding corticotropin-releasing factor (CRF), type 1 CRF receptor, and CRF-binding protein and localization of the gene products in the human ovary.
8612563 1996 Cloning and characterization of human urocortin.
8557170 1995 Corticotropin releasing factor (CRF) binding protein: a novel regulator of CRF and related peptides.
8307998 1994 Assignment of disulfide bonds in corticotropin-releasing factor-binding protein.
8198617 1993 Cloning and structure of the human corticotrophin releasing factor-binding protein gene (CRHBP)
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7774945 1995 Mapping the human corticotropin releasing hormone binding protein gene (CRHBP) to the long arm of chromosome 5 (5q11.2-q13.3).
7477348 1995 Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease.
2549150 1989 Isolation of the human plasma corticotrophin-releasing factor-binding protein.
1846945 1991 Cloning and characterization of the cDNAs for human and rat corticotropin releasing factor-binding proteins.