Property Summary

NCBI Gene PubMed Count 178
PubMed Score 5615.43
PubTator Score 4955.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Pituitary apoplexy 3

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.000 4.9e-03
ependymoma -3.500 4.2e-03
oligodendroglioma -3.200 2.8e-03
glioblastoma -3.000 5.4e-07
osteosarcoma -2.545 1.8e-03
sonic hedgehog group medulloblastoma -3.500 8.1e-04
medulloblastoma, large-cell -1.300 3.3e-02
primitive neuroectodermal tumor -2.400 1.1e-02
pediatric high grade glioma -2.900 7.8e-04
atypical teratoid/rhabdoid tumor -1.100 3.2e-02
pilocytic astrocytoma -3.500 4.8e-06
Pick disease -1.300 3.1e-03
Down syndrome -2.000 1.5e-03

Gene RIF (146)

PMID Text
26882083 These results suggest that the CRH and CRH-BP genes have no direct effect on Irritable bowel syndrome status.
26350463 results show that activation of CRH receptors by CRH ligands stimulates VEGF-A expression in intestinal epithelial cells through the cAMP/CREB pathway
26331704 Placenta CRH mRNA concentration appears to convey information about the risk of brain damage in the infant born at an extremely low gestational age.
26307012 results suggest that glucocorticoids induce a transcription complex consisting of RelB/p52, CBP, and HDAC1 that triggers a dynamic acetylation-mediated epigenetic change to induce CRH expression in full-term human placenta.
26212818 This corticotropin releasing factor-induced regulation on norepinephrine transporter expression and function may play a role in development of stress-related depression and anxiety
26074267 Data suggest that signal transduction involving corticotropin-releasing factor (CRH) and CRH receptors (CRHR) taking place in cochlea are involved in protecting against noise-induced hearing loss. [REVIEW]
26055202 This study evaluated the associations of CRH polymorphisms with susceptibility to MDD and response to antidepressant treatment
25771405 Interaction of RelB with the CRH or COX-2 gene promoters decreased when STAT3 was depleted.
25673853 we show that Abeta species can hyperexcite CRF neurons, providing a mechanism by which Abeta influences stress-related symptoms
25630718 the present study demonstrates that the expression of CRH/CRH-R1 in lesions of chronic plaque psoriasis is lower than that in psoriatic perilesional skin and normal control skin.
25591114 Placental CRH exposure may make a unique contribution to fetal programming of obesity risk.
25339828 Production of CRF and UCN1 in human dendritic cells is strongly augmented by commensal intestinal bacteria.
24985398 High serum corticotropin-releasing hormone (CRH) and bone marrow mast cell CRH receptor expression in a mastocytosis patient.
24841552 Results suggest that ULBP2 is expressed and released from cervical cancer cells by CRF, which regulates NKG2D expression in natural killer cells.
24835211 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes.
24597258 as labor progresses, progesterone and corticotropin-releasing hormone increase and subsequently decrease precipitously in the immediate postpartal period
23987517 During the midluteal phase of the cycle, metformin may decrease the production of CRH and urocortin in the endometrium.
23933692 Data suggest that expression of CRF, CRF-related neuropeptides, and CRF receptors in the liver plays crucial regulatory roles in homeostasis, in allostasis to endogenous stresses, and in adaptation to exogenous stress stimuli. [REVIEW]
23928667 IL-6 and CRH are both secreted in a pulsatile fashion during the active phase of human labor. The time-integrated concentrations of the two hormones are positively correlated, with IL-6 leading CRH secretion.
23849813 This review focuses on the CRF receptor, a stress-related peptide implicated in diverse psychiatric and medical disorders that are more prevalent in females in diverse psychiatric and medical disorders that are more prevalent in females.
23666959 CRH/CRHR1 are involved in regulation of PGHS2 (prostaglandin-endoperoxide synthase 2) expression in myometrium before/during labor; these actions appear important in priming myometrium for labor and adaptive responses to inflammatory mediators.
23644483 Postnatally stressed adult transgenic mice have decreased hippocampal nectin-3 levels, which could be attenuated by CRHR1 inactivation and mimicked by corticotropin-releasing hormone (CRH) overexpression in forebrain neurons.
23593457 A novel CRH missense mutation (Pro30Arg) results in reduced levels of protein secretion in the short time thus suggesting that mutated people could present an altered capability to respond immediately to stress agents.
23478074 corticotrophin-releasing hormone (CRH) might play a significant role in the pathogenesis of intrahepatic cholestasis of pregnancy(ICP) and provide a new approach to further investigate the etiology of ICP
23477585 CRH may be involved in the pathogenesis of gastric cancer
23466050 Data suggest that CRF plays role in acute postinjury gut dysfunction; CRF is expressed in small bowel of elective/emergency gastrointestinal (GI) surgery patients with concomitant GI dysfunction; plasma CRF correlates with poor gastric emptying.
23416839 in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation.
23380766 evidence suggests that CRH regulates neurogenesis in the brain.
23371389 ERK1/2 activation in response to CRH is biphasic, involving a first cAMP- and B-Raf-dependent early phase and a second phase that critically depends on CRHR1 internalization and beta-arrestin2.
23076876 study demonstrates that the HeLa cervical cancer cell line expresses CRH; additionally, CRH was shown to induce FasL expression
22869609 CRH acts on CRHR1 to activate different signaling pathways before and after onset of labor, thereby resulting in differential calcium signaling in response to CRH.
22768175 These data demonstrate that CRF triggers increases in intestinal paracellular permeability via mast cell dependent release of TNF-alpha and proteases.
22763913 The aberrant expression of corticotropin-releasing hormone in pre-eclampsia may activate the FasL-positive decidual macrophages, impair the physiological turnover of extravillous trophoblasts, and eventually disturb placentation.
22734038 RelB/NF-kappaB2, is constitutively activated in the human placenta, which binds to a previously undescribed NF-kappaB enhancer of corticotropin-releasing hormone (CRH) gene promoter to regulate CRH expression.
22703673 Stress-induced response of CRH is differentially modulated by CRH promoter polymorphisms in rheumatoid arthritis patients.
22608025 no association found between promoter polymorphisms and preterm birth in a Hispanic population
22535604 The results give evidence of a possible participation of CRF and receptor for endothelin B in the pathogenesis of the itch in the dermatitis herpetiformis and bullous pemphigoid.
22533365 the age-associated changes in the expression of CRH system components reflect an exaggerated stress response reaction, putting the aged skin continuously in a stress-like situation.
22360979 increased serum levels in psoriasis and atopic dermatitis patients
22234467 in placenta, CRH produced locally regulates GLUT1 and GLUT3 expression, CRHR1 and CRHR2-mediated differential regulation of GLUT1 and GLUT3 expression
22201770 review tissue specific differences in CRH gene expression, and discuss how epigenetic chromatin modification mechanisms can relate to tissue specific differences in expression of CRH (review)
22073145 study suggests that in humans and in rats, septic shock is associated with decreased ACTH synthesis that is not compensated by its two natural secretagogues, AVP and CRH
22045495 The results of this study suggested genetic increases in the brain of CRF expression mimicked chronic stress on the effects of amyloid deposition, neurodegeneration, and behavioral deficits.
21765902 The immunomodulatory effects of CRH may include an important, albeit not explored yet, role in epidermal tissue remodeling and regeneration and maintenance of tissue homeostasis.
21525005 central AT(1) receptor signaling plays a homeostatic role in the regulation of food intake by maintaining gene expression of Crh in hypothalamus
21360527 Confirm the anti-inflammatory function of VIP, through the modulation of the expression of CRF system that impacts in a reduction of mediators with inflammatory/destructive functions.
21289256 Women with endometriosis show an impaired endometrial expression of CRH and Ucn mRNA.
21261589 REVIEW: role of corticotropin-releasing hormone in the pathophysiology of depression
21106714 Our findings showed a significant impact of premature rupture of membranes with chorioamnionitis on placental CRH peptides and receptors, suggesting that placental expression of stress-related pathways is activated in infective process
20943787 Higher midpregnancy placental CRH was not associated with an increased risk of postpartum depression.
20727865 A large literature dealing with various stressors that regulate gonadotrophin-releasing hormone secretion in a variety of species provides evidence that stress modulates GnRH secretion by activating the corticotrophin-releasing factor system--REVIEW
20626567 The phosphorylation of CREB contributes to the activation of CRF gene transcription after the deprivation of glucocorticoids in hypothalamic cells.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20472145 Forskolin-stimulated corticotropin releasing factor gene transcription is mediated by CRE, which included from - 220 to - 233, on the CRF 5'-promoter region.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20403506 Observational study of gene-disease association. (HuGE Navigator)
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20047160 Validated animal models of the stress component of addiction suggest that corticotropin-releasing factor systems are a viable target for the development of future medications for drug addiction--REVIEW
20043013 We demonstrate that human skin is an extramedullary reservoir for mast cell precursors, and we have identified a regulatory loop between CRH and stem cell factor signaling
19889985 Because both the corticotropin-releasing factor (CRF) and serotonin brain systems are strongly implicated in anxiety-related behaviors, their interaction may play a crucial role in the induction of persistent behavioral changes by stress.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19723618 Observational study of gene-disease association. (HuGE Navigator)
19628576 In THP-1 cells, CRF activates the phosphatidylinositol 3-kinase/Akt and ERK1/2 pathways.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19460861 Cx43 is a potential mediator of the neuroprotective actions of CRH
19453261 Observational study of gene-disease association. (HuGE Navigator)
19450691 The crystal structure of human Brn-5 transcription factor in complex with corticotropin-releasing hormone gene promoter reveals an unexpected recognition mode of the protein to its cognate DNA
19409922 genetic variations in CRF or CRF1 may confer a susceptibility to alcohol--REVIEW
19404232 Bcl-2, hpGH and CRH are down regulated in the small for gestational age group in comparison to the control group.
19379831 The corticotropin-releasing factor (CRF) system is principal neuroendocrine coordinator of stress responses involved in inflammatory process in the gastrointestinal tract via vagal and peripheral pathways, as implied by multiple reports reviewed here.
19258402 A rationale for the use of CRH in predicting preterm birth.
19246974 The regulatory elements, including CRE, negative glucocorticoid regulatory element, and a serum response element on the promoter, contribute to the regulation of CRF gene transcription in hypothalamic 4B cells.
19190112 Higher maternal blood levels of CRH were associated with higher levels of adiponectin but unchanged levels of leptin at age 3 yr.
19177170 The cross talk between the two main signaling pathways involved in activation and repression of corticotrophin releasing hormone (CRH) mRNA expression: cyclic AMP (cAMP) and GR, was investigated.
19131402 In black women, the AG genotype at CRH + 3362 or CRH - 1667 is associated with lower Nugent scores compared with the homozygous genotypes.
19131402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19127063 Results suggest that exposure to low levels of placental corticotropin-releasing hormone early in gestation may be optimal and associated with a response pattern indicating greater maturity.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19031275 The relation of corticotropin releasing hormone with preterm delivery is moderated by exposure to chronic stressors during pregnancy.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18844820 In the here reported family, a causative role in NFLE pathogenesis appeared to be limited to the g.-1470C > A variation (which increases CRH levels).
18838498 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18803662 Exposure of dendritic cells to CRF resulted in a decrease of IL-18 in patients with atopic dermatitis and healthy persons. CRF could modulate immune responses by acting directly upon dendritic cells.
18662259 question if CRH mRNA and number of microparticles are appropriate markers of placental debris
18597742 In summary, our results confirm the stimulation of ER alpha and ER beta on CRH expression and demonstrate the important roles of the ERE half sites and CRE for the action of ER alpha and ER beta.
18456686 Observational study of gene-disease association. (HuGE Navigator)
18404132 SUMO1 participates in the modulation of ER-mediated CRH mRNA expression which may be important for the regulation of the stress response.
18384079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18329818 Corticotropin-releasing hormone had sleep-improving and REM permissive effects when co-administered with ghrelin.
18295412 CSF concentrations of the stress hormones norepinephrine and CRH differentially change after exposure to 1h of trauma-related audiovisual stimulation in chronic, combat-related PTSD.
18234674 CRF-BP has distinct and separable binding surfaces for CRF and Ucn 1
18212352 phorbol ester stimulates CRH gene transcriptional activity through the CRE, suggesting that cross-talk between PKC and protein kinase A signaling pathways targets this regulatory element in placental cells
18182033 fetal CRH mRNA levels in maternal blood, is related to coagulation potential, i.e. FVII activity, but not to markers of coagulation or endothelial activation in pre-eclampsia
17959886 Corticotrophin-releasing hormone induces ACTHR receptor as potently as ACTH during late gestation.
17766644 Data describe the discovery of phosphocholine attached to a number of placental hormones, and notes significant concentrations of immunoreactive CRF and proCRF peptides in rat placental and plasma extracts.
17693031 Acute GES reduces the number of CRF-producing neurons and decreases CRF expression in PVN during post-operative gastric ileus.
17676473 Network analysis showed that AA have retained an ancestral CRH haplotype, while the most common EA haplotype is derived from a single recombination event.
17667919 Corticotropin-releasing hormone produced by ovarian cancer might favour survival and progression of the tumour by promoting its immune privilege.
17568667 findings suggest that CRH augments LPS induced cytokine secretion in human trophoblast cells. Modulation of LPS induced immune responses by CRH may be mediated through regulation of TLR-4 and selective activation of the p38/MAPK signalling pathway.
17554801 CRH, PLAC1, and selectin-P are distributed differently in preeclampsia cases compared to controls and correlate with signs of preeclampsia.
17294739 The elevated level of placental CRH may be a trigger of the transcription of its own receptor CRH-R1 during caesarian operations.
17068474 CRH mediates inflammation induced by lipopolysaccharide in human adult epidermal keratinocytes
16984517 findings suggest that the increased levels of tumor necrosis factor-alpha and corticotropin-releasing hormone found in pregnant women presenting with preterm labor may be involved in the pathophysiological mechanism of the latter
16740657 Ultraviolet B radiation induces CRH production in human melanocytes through stimulation of the protein kinase A pathway
16734917 detection of substantial expression of the CRH and its receptor proteins, as well as receptor mRNA in the cervix suggests that the cervix may be a target for CRH action
16675846 CRH peptides can differentially influence hair follicle melanocyte behavior not only via CRH-R1 signaling but also by complex cross-talk between CRH-R1 and CRH-R2.
16639867 Nonalcoholic subjects with a family history of alcoholism exhibit lower plasma ACTH and beta-endorphin as well as lower ACTH, cortisol, and beta-endorphin responses to psychological stress and CRH stimulation.
16523405 CRH promoter reactivity varies between the compound promoter alleles.
16446741 Colocalization of CRH and nuclear/cytoplasmic androgen receptor (AR) was found in neurons of the human hypothalamic paraventricular nucleus (PVN). In the presence of testosterone, recombinant human AR bound to CRH-androgen-responsive elements.
16309788 during pregnancy, early detection of stress signals by the placenta stimulate the subsequent release of CRH and may result in increased risk for preterm delivery
16245303 CRH and related peptides can couple CRH-R1 to any of diverse signal transduction pathways; they also regulate cell viability and proliferation in cell type and growth condition-dependent manners.
16222669 CRH genetic alterations could explain several autosomal dominant nocturnal frontal lobe epilepsy clinical features
15883387 Ileal-specific CRF promotes inflammation and modulates bowel motility.
15816833 CRH regulates IL-18 production through the MAPK signaling pathway in human keratinocytes.
15591024 calcium/calmodulin-dependent protein kinase IV signaling pathway may play an important role in the excitation-mediated regulation of CRH synthesis
15468147 CRH inhibited the transition of keratinocytes from G0/1 to S phase of the cell cycle, which was accompanied by an increased expression of cdk inhibitor p16 (Ink4a) protein
15126558 CRH promoter region between -248 and -213 bp was essential for the effect of both E2 and ICI 182780. This region contains a consensus cAMP regulatory element that is a requirement for E2- and ICI 182780-mediated activity.
15077295 CRH plays pathogenic role in modulating inflammatory joint disease with CREB/ATF family of transcription factors as principal effector molecules of proinflammatory mediator action in rheumatoid arthritis.
15072543 The high expression of CRH in placenta and in choriodecidua and myometrium suggested that CRH derived from placenta exerts direct or indirect actions on these tissues.
14706771 Expression of urocortin mRNA is significantly downregulated in the Edinger-Westphal nucleus of CRF-overexpressing transgenic mice compared with wild-type.
14698679 CRH administration induced sympathotonic effects which were antagonized by ANP
14675801 An association between an allele of the CRH-linked locus and behavioral inhibtion. Among offspring of parents with panic disorder, this association was marked.
14675201 corticotropin-releasing hormone inhibits nuclear factor-kappaB binding and transcriptional activity.
14667971 progesterone, corticotropin-releasing factor, and activin A have roles in paracrine regulation of endometrial function [review]
14576187 human cord blood-derived cultured mast cells (hCBMC) at 10 wk, but not at 2 wk, are immunocytochemically positive for CRH and urocortin
14573312 Observational study of gene-disease association. (HuGE Navigator)
12853091 reduced levels of circulating corticotropin releasing factor were associated with increased uterine artery resistance
12784189 Detected in placenta, myometrium, decidua, and fetal membranes. Widespread expression of CRH system in gestational tissue suggests paracrine role CRH in birth process (e.g. effects on macrophages and endothelial cells).
12734882 Observational study of gene-disease association. (HuGE Navigator)
12679466 in chorion trophoblast cells, endogenously produced corticotropin-releasing hormone exerts a tonic stimulatory effect on 15-hydroxyprostaglandin dehydrogenase activity
12583606 Placenta takes part in stress syndrome by releasing CRF, which may help to influence uterine perfusion, maternal metabolism, fluid balance, and uterine contractility, protecting fetus from hostile environment.(review)
12450317 CRH exerts inhibitory effects on steroidogenesis in rat and human granulosa cells, acting through the CRH receptor.
12429558 Intraventricular insulin potentiates the anorexic effect of corticotropin releasing hormone in rats
12154211 Observational study of gene-disease association. (HuGE Navigator)
12114295 CRH modulates human cardiovascular and pupillary autonomic reflexes.
12062896 AP-2alpha modulates human corticotropin-releasing hormone gene expression in the placenta by direct protein-protein interaction.
12051390 Observational study of gene-disease association. (HuGE Navigator)
11936276 The ability of CRH to induce POMC expression in cultured melanoma cells; in CRH positive melanomas, seven out of nine cases (78%) of primary melanoma, and 7 out of 12 cases (58%) of MetM showed colocalization of CRH and POMC peptides
11932939 NPY regulates the CRH system of the human hypothalamus and some of the effects of NPY on metabolic, autonomic, and endocrine functions may be mediated through CRH
11854458 during pregnancy CRH primarily activates intracellular signals that contribute to the maintenance of myometrial quiescence.
11555839 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11406119 Findings of slightly diminished cerebrospinal fluid CRH levels after feeding may be accounted for by the rises in glucocorticoids and their associated negative feedback effects on central nervous system CRH.
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE      1 - 70
EYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNA     71 - 140
LGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK                  141 - 196
//

Text Mined References (177)

PMID Year Title
26882083 2016 Associations between Single-Nucleotide Polymorphisms in Corticotropin-Releasing Hormone-Related Genes and Irritable Bowel Syndrome.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26350463 2015 Corticotropin Releasing Hormone and Urocortin 3 Stimulate Vascular Endothelial Growth Factor Expression through the cAMP/CREB Pathway.
26331704 2016 Brain disorders associated with corticotropin-releasing hormone expression in the placenta among children born before the 28th week of gestation.
26307012 2015 RelB/p52-mediated NF-?B signaling alters histone acetylation to increase the abundance of corticotropin-releasing hormone in human placenta.
26212818 2015 Corticotropin releasing factor up-regulates the expression and function of norepinephrine transporter in SK-N-BE (2) M17 cells.
26074267 2015 Cellular signaling protective against noise-induced hearing loss – A role for novel intrinsic cochlear signaling involving corticotropin-releasing factor?
26055202 2015 Association analysis for corticotropin releasing hormone polymorphisms with the risk of major depressive disorder and the response to antidepressants.
25771405 2015 STAT3 cooperates with the non-canonical NF-?B signaling to regulate pro-labor genes in the human placenta.
25673853 2015 Posttraumatic stress disorder-like induction elevates ?-amyloid levels, which directly activates corticotropin-releasing factor neurons to exacerbate stress responses.
25630718 2015 Inhibiting interleukin-18 production through the mitogen-activated protein kinase pathway, a potential role of corticotropin-releasing hormone in chronic plaque psoriasis.
25591114 2015 Fetal programming of children's obesity risk.
25573209 2015 Corticotropin releasing hormone and imaging, rethinking the stress axis.
25521515 2015 A second corticotropin-releasing hormone gene (CRH2) is conserved across vertebrate classes and expressed in the hindbrain of a basal neopterygian fish, the spotted gar (Lepisosteus oculatus).
25416956 2014 A proteome-scale map of the human interactome network.
25339828 2014 Production of corticotropin-releasing factor and urocortin from human monocyte-derived dendritic cells is stimulated by commensal bacteria in intestine.
24985398 2014 High serum corticotropin-releasing hormone (CRH) and bone marrow mast cell CRH receptor expression in a mastocytosis patient.
24841552 2014 Corticotropin-releasing factor induces immune escape of cervical cancer cells by downregulation of NKG2D.
24835211 2014 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes and the differentiation of mouse 3T3L1 pre-adipocytes.
24597258 2013 Corticotropin-releasing hormone and progesterone plasma levels association with the onset and progression of labor.
23987517 2013 Metformin reduces the expression of corticotropin-releasing hormone and urocortin in the endometrium of healthy women.
23933692 The corticotropin releasing factor system in the liver: expression, actions and possible implications in hepatic physiology and pathology.
23928667 2013 Pulsatile interleukin-6 leads CRH secretion and is associated with myometrial contractility during the active phase of term human labor.
23849813 2013 Sex-specific cell signaling: the corticotropin-releasing factor receptor model.
23666959 2013 Corticotropin-releasing hormone interacts with interleukin-1? to regulate prostaglandin H synthase-2 expression in human myometrium during pregnancy and labor.
23644483 2013 Nectin-3 links CRHR1 signaling to stress-induced memory deficits and spine loss.
23593457 2013 Functional characterization of a CRH missense mutation identified in an ADNFLE family.
23478074 2013 Expression of corticotrophin-releasing hormone and its receptor in patients with intrahepatic cholestasis of pregnancy.
23477585 2013 Corticotropin releasing hormone is correlated with tumorigenesis of gastric cancer.
23466050 2013 Corticotropin-releasing factor is present in intestinal tissue of patients with gastrointestinal dysfunction following shock and abdominal surgery.
23416839 2013 Involvement of Nurr-1/Nur77 in corticotropin-releasing factor/urocortin1-induced tyrosinase-related protein 1 gene transcription in human melanoma HMV-II cells.
23380766 2013 Corticotropin-releasing hormone exerts direct effects on neuronal progenitor cells: implications for neuroprotection.
23371389 2013 B-Raf and CRHR1 internalization mediate biphasic ERK1/2 activation by CRH in hippocampal HT22 Cells.
23076876 2013 Corticotropin-releasing hormone (CRH) is expressed in the human cervical carcinoma cells (HeLa) and upregulates the expression of Fas ligand.
22869609 2012 CRH activation of different signaling pathways results in differential calcium signaling in human pregnant myometrium before and during labor.
22768175 2012 CRF induces intestinal epithelial barrier injury via the release of mast cell proteases and TNF-?.
22763913 2012 Aberrant expression of corticotropin-releasing hormone in pre-eclampsia induces expression of FasL in maternal macrophages and extravillous trophoblast apoptosis.
22734038 2012 RelB/NF-?B2 regulates corticotropin-releasing hormone in the human placenta.
22703673 Corticotropin releasing hormone (CRH) response in patients with early rheumatoid arthritis due to polymorphisms in the CRH gene.
22666496 2012 Genome-wide study of gene variants associated with differential cardiovascular event reduction by pravastatin therapy.
22608025 2012 Lack of association between two polymorphisms in the corticotropin-releasing hormone gene promoter and preterm birth in a Hispanic population.
22535604 2012 Expression of selected neuropeptides in pathogenesis of bullous pemphigoid and dermatitis herpetiformis.
22533365 2012 Aging-related changes in cutaneous corticotropin-releasing hormone system reflect a defective neuroendocrine-stress response in aging.
22360979 2012 Increased serum CRH levels with decreased skin CRHR-1 gene expression in psoriasis and atopic dermatitis.
22234467 2012 Differential regulation of glucose transporters mediated by CRH receptor type 1 and type 2 in human placental trophoblasts.
22201770 2012 Tissue specific epigenetic differences in CRH gene expression.
22073145 2011 Changes in CRH and ACTH synthesis during experimental and human septic shock.
22045495 2012 Corticotrophin releasing factor accelerates neuropathology and cognitive decline in a mouse model of Alzheimer's disease.
21765902 2011 A novel role of peripheral corticotropin-releasing hormone (CRH) on dermal fibroblasts.
21525005 2011 Angiotensin II type 1 receptor signaling regulates feeding behavior through anorexigenic corticotropin-releasing hormone in hypothalamus.
21360527 2011 Mapping the CRF-urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide.
21289256 2011 Impaired CRH and urocortin expression and function in eutopic endometrium of women with endometriosis.
21261589 2011 The role of corticotropin-releasing hormone in the pathophysiology of depression: therapeutic implications.
21106714 2011 Changes in placental CRH, urocortins, and CRH-receptor mRNA expression associated with preterm delivery and chorioamnionitis.
20943787 2011 Elevated corticotropin releasing hormone (CRH) during pregnancy and risk of postpartum depression (PPD).
20727865 2010 Corticotrophin-releasing factor and stress-induced inhibition of the gonadotrophin-releasing hormone pulse generator in the female.
20626567 2010 Corticotrophin-releasing factor gene transcription is directly activated after deprivation of glucocorticoids in hypothalamic cells.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20472145 2010 Transcriptional regulation of hypothalamic corticotropin-releasing factor gene.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20403506 2010 Genetic variation in neuroendocrine genes associates with somatic symptoms in the general population: results from the EPIFUND study.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20047160 2010 Neurobiological mechanisms of addiction: focus on corticotropin-releasing factor.
20043013 2010 Corticotropin-releasing hormone stimulates the in situ generation of mast cells from precursors in the human hair follicle mesenchyme.
19889985 2009 Deciphering the interaction of the corticotropin-releasing factor and serotonin brain systems in anxiety-related disorders.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19723618 2010 Genetic variation in the hypothalamic-pituitary-adrenal stress axis influences susceptibility to musculoskeletal pain: results from the EPIFUND study.
19628576 2009 Activation of phosphatidylinositol 3-kinase/protein kinase B by corticotropin-releasing factor in human monocytes.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19460861 2009 Increased connexin 43 expression as a potential mediator of the neuroprotective activity of the corticotropin-releasing hormone.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19450691 2009 Structure of human Brn-5 transcription factor in complex with CRH gene promoter.
19409922 2009 Gene-environment interactions resulting in risk alcohol drinking behaviour are mediated by CRF and CRF1.
19404232 2009 Study of apoptosis and related proteins, CRH and hpGH in placentas of newborns small for gestational age (SGA).
19379831 2009 The corticotropin-releasing factor system in inflammatory bowel disease: prospects for new therapeutic approaches.
19258402 2009 Patterns of plasma corticotropin-releasing hormone, progesterone, estradiol, and estriol change and the onset of human labor.
19246974 2008 Involvement of regulatory elements on corticotropin-releasing factor gene promoter in hypothalamic 4B cells.
19190112 2009 Maternal levels of corticotropin-releasing hormone during pregnancy in relation to adiponectin and leptin in early childhood.
19177170 2009 Timing is critical for effective glucocorticoid receptor mediated repression of the cAMP-induced CRH gene.
19131402 2009 Predicting risk of bacterial vaginosis: the role of race, smoking and corticotropin-releasing hormone-related genes.
19127063 2008 Low levels of corticotropin-releasing hormone during early pregnancy are associated with precocious maturation of the human fetus.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19031275 2008 Exploring the relationship of second-trimester corticotropin releasing hormone, chronic stress and preterm delivery.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18844820 2008 Compound heterozygosity with dominance in the Corticotropin Releasing Hormone (CRH) promoter in a case of nocturnal frontal lobe epilepsy.
18838498 2010 Association of HPA axis genes with suicidal behaviour in schizophrenia.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18803662 2009 Corticotropin-releasing factor decreases IL-18 in the monocyte-derived dendritic cell.
18801728 2008 Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1.
18662259 2008 Placental corticotrophin-releasing hormone mRNA and microparticles in maternal plasma are not measures of placental shedding of debris: a rebuttal.
18597742 2008 Estrogen receptor-alpha and -beta regulate the human corticotropin-releasing hormone gene through similar pathways.
18559919 2008 Amniotic fluid and umbilical cord plasma corticotropin-releasing factor (CRF), CRF-binding protein, adrenocorticotropin, and cortisol concentrations in intraamniotic infection and inflammation at term.
18456686 2008 Association between birth weight and adolescent systolic blood pressure in a caucasian birth cohort differs according to skin type, CRH promoter or 11beta-HSD2 genotype.
18404132 2008 SUMO1 enhances 17-beta estradiol's effect on CRH promoter activation through estrogen receptors.
18384079 2008 Combined effects of exonic polymorphisms in CRHR1 and AVPR1B genes in a case/control study for panic disorder.
18329818 2008 Ghrelin alone or co-administered with GHRH or CRH increases non-REM sleep and decreases REM sleep in young males.
18295412 2008 Effects of trauma-related audiovisual stimulation on cerebrospinal fluid norepinephrine and corticotropin-releasing hormone concentrations in post-traumatic stress disorder.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18234674 2008 Residues of corticotropin releasing factor-binding protein (CRF-BP) that selectively abrogate binding to CRF but not to urocortin 1.
18212352 2008 Phorbol ester stimulates corticotropin-releasing hormone gene promoter activity through a cAMP regulatory element in primary placental cells.
18182033 2008 Fetal corticotrophin-releasing hormone mRNA, but not phosphatidylserine-exposing microparticles, in maternal plasma are associated with factor VII activity in pre-eclampsia.
17959886 2007 The regulation of adrenocorticotrophic hormone receptor by corticotropin-releasing hormone in human fetal adrenal definitive/transitional zone cells.
17766644 2007 Identification of a novel mammalian post-translational modification, phosphocholine, on placental secretory polypeptides.
17693031 2007 Gastric electrical stimulation modulates hypothalamic corticotropin-releasing factor-producing neurons during post-operative ileus in rat.
17676473 2007 Corticotropin releasing hormone (CRH) gene variation: comprehensive resequencing for variant and molecular haplotype discovery in monosomic hybrid cell lines.
17667919 2007 Intratumoral CRH modulates immuno-escape of ovarian cancer cells through FasL regulation.
17568667 2007 Corticotropin releasing hormone modulates endotoxin-induced inflammatory cytokine expression in human trophoblast cells.
17554801 2007 Cell-free mRNA concentrations of CRH, PLAC1, and selectin-P are increased in the plasma of pregnant women with preeclampsia.
17294739 2007 [Action of corticotropin-releasing hormone on its own receptor type-1 in human placenta].
17068474 2007 CRH mediates inflammation induced by lipopolysaccharide in human adult epidermal keratinocytes.
16984517 2006 Association between serum tumor necrosis factor-alpha and corticotropin-releasing hormone levels in women with preterm labor.
16740657 2006 Characterization of a ultraviolet B-induced corticotropin-releasing hormone-proopiomelanocortin system in human melanocytes.
16734917 2006 Corticotropin-releasing hormone, its binding protein and receptors in human cervical tissue at preterm and term labor in comparison to non-pregnant state.
16675846 2006 Modulation of the human hair follicle pigmentary unit by corticotropin-releasing hormone and urocortin peptides.
16639867 Modified dexamethasone suppression-corticotropin-releasing hormone stimulation test: A pilot study of young healthy volunteers and implications for alcoholism research in adolescents and young adults.
16523405 2006 Promoter polymorphisms regulating corticotrophin-releasing hormone transcription in vitro.
16446741 2006 A direct androgenic involvement in the expression of human corticotropin-releasing hormone.
16309788 2006 Elevated maternal cortisol early in pregnancy predicts third trimester levels of placental corticotropin releasing hormone (CRH): priming the placental clock.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16245303 2006 CRH functions as a growth factor/cytokine in the skin.
16222669 2005 Frontal lobe epilepsy and mutations of the corticotropin-releasing hormone gene.
15883387 2005 Role of peripheral corticotropin-releasing factor and urocortin II in intestinal inflammation and motility in terminal ileum.
15816833 2005 Corticotropin-releasing hormone (CRH) downregulates interleukin-18 expression in human HaCaT keratinocytes by activation of p38 mitogen-activated protein kinase (MAPK) pathway.
15591024 2004 Calcium/calmodulin kinase IV pathway is involved in the transcriptional regulation of the corticotropin-releasing hormone gene promoter in neuronal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15468147 2005 Corticotropin-releasing hormone induces keratinocyte differentiation in the adult human epidermis.
15126558 2004 Estrogen receptor-mediated down-regulation of corticotropin-releasing hormone gene expression is dependent on a cyclic adenosine 3',5'-monophosphate regulatory element in human placental syncytiotrophoblast cells.
15077295 2004 Cyclooxygenase 2-derived prostaglandin E2 production by corticotropin-releasing hormone contributes to the activated cAMP response element binding protein content in rheumatoid arthritis synovial tissue.
15072543 2004 mRNA expression profiles for corticotrophin-releasing hormone, urocortin, CRH-binding protein and CRH receptors in human term gestational tissues determined by real-time quantitative RT-PCR.
14706771 2004 Urocortin expression in the Edinger-Westphal nucleus is down-regulated in transgenic mice over-expressing neuronal corticotropin-releasing factor.
14698679 2003 Modulation of sympathetic activity by corticotropin-releasing hormone and atrial natriuretic peptide.
14675801 2003 Association of a genetic marker at the corticotropin-releasing hormone locus with behavioral inhibition.
14675201 2003 Corticotropin-releasing hormone inhibits nuclear factor-kappaB pathway in human HaCaT keratinocytes.
14667971 2003 Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A.
14576187 2004 Corticotropin-releasing hormone and its structurally related urocortin are synthesized and secreted by human mast cells.
14573312 2003 The corticotropin-releasing hormone binding protein is associated with major depression in a population from Northern Sweden.
12895416 2003 Corticotropin-releasing factor requires CRF binding protein to potentiate NMDA receptors via CRF receptor 2 in dopamine neurons.
12853091 2003 Impaired uterine artery blood flow at mid gestation and low levels of maternal plasma corticotropin-releasing factor.
12784189 2003 Expression patterns of CRH, CRH receptors, and CRH binding protein in human gestational tissue at term.
12734882 2003 Corticotropin-releasing hormone promoter polymorphisms in patients with rheumatoid arthritis from northwest Spain.
12679466 2003 Regulation of 15-hydroxy prostaglandin dehydrogenase by corticotrophin-releasing hormone through a calcium-dependent pathway in human chorion trophoblast cells.
12583606 2002 Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450317 2002 Role of corticotropin-releasing hormone in ovarian steroidogenesis.
12429558 2002 Intraventricular insulin potentiates the anorexic effect of corticotropin releasing hormone in rats.
12154211 2002 Neuroendocrine gene polymorphisms and susceptibility to juvenile idiopathic arthritis.
12062896 2002 AP-2alpha modulates human corticotropin-releasing hormone gene expression in the placenta by direct protein-protein interaction.
12051390 Corticotropin releasing hormone promoter polymorphisms in giant cell arteritis and polymyalgia rheumatica.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12011471 2002 Corticotropin-releasing hormone: an autocrine hormone that promotes lipogenesis in human sebocytes.
11936276 2002 The expression of corticotropin-releasing hormone in melanoma.
11932939 2002 Corticotropin-releasing hormone-synthesizing neurons of the human hypothalamus receive neuropeptide Y-immunoreactive innervation from neurons residing primarily outside the infundibular nucleus.
11555839 2001 A polymorphism in the regulatory region of the corticotropin-releasing hormone gene in relation to cortisol secretion, obesity, and gene-gene interaction.
11511529 2001 In situ expression of corticotropin-releasing hormone (CRH) and proopiomelanocortin (POMC) genes in human skin.
11341487 2001 Decreased cerebrospinal fluid levels of beta-endorphin and ACTH in children with infantile spasms.
11182747 2001 Corticotrophin-releasing hormone and ACTH levels in maternal and fetal blood during spontaneous and oxytocin-induced labour.
11168450 2001 Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
10822340 2000 Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function.
9783915 1998 Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells.
9620773 1998 Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1.
9178757 1997 Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach.
8386360 1993 Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics.
8243338 1993 Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor.
8161822 1993 Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene.
7867564 1995 Ligand requirements of the human corticotropin-releasing factor-binding protein.
7589495 1995 Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin.
7585095 1995 A placental clock controlling the length of human pregnancy.
7489943 1995 Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis.
7477348 1995 Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease.
6605851 1983 Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene.
3262120 1988 Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta.
3259914 1988 Human corticotropin releasing hormone gene is located on the long arm of chromosome 8.
2783917 1989 Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing.
2365075 1990 Structural analysis of the regulatory region of the human corticotropin releasing hormone gene.