Property Summary

NCBI Gene PubMed Count 102
PubMed Score 812.76
PubTator Score 510.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
hepatocellular carcinoma -1.200 2.8e-05
pancreatic cancer -1.300 1.8e-03
astrocytic glioma -2.100 2.8e-02
oligodendroglioma -2.100 3.2e-02
cutaneous lupus erythematosus 1.200 1.9e-03
osteosarcoma 1.648 3.9e-04
medulloblastoma -1.200 8.6e-04
medulloblastoma, large-cell -2.300 1.4e-04
adrenocortical carcinoma -2.545 2.0e-11
pancreatic ductal adenocarcinoma liver m... -1.100 3.1e-02
tuberculosis -3.600 2.4e-06
non-small cell lung cancer -1.059 1.4e-10
intraductal papillary-mucinous carcinoma... -1.300 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
lung cancer -1.300 7.6e-03
colon cancer -1.300 1.8e-02
interstitial cystitis 1.200 3.8e-03
pancreatic carcinoma -1.300 1.8e-03
lung adenocarcinoma -1.002 7.9e-07
gastric carcinoma 1.300 2.7e-02
invasive ductal carcinoma 1.700 1.4e-02
ulcerative colitis 1.700 5.8e-08
ovarian cancer 1.600 1.2e-03
pituitary cancer -1.800 1.0e-07
chronic rhinosinusitis -1.203 4.7e-03

Gene RIF (69)

PMID Text
26601115 CREMalpha SNPs rs2295415 and rs1057108 may be novel genetic susceptibility factors for SLE, especially at haplotype level.
25401338 overexpressed in the nuclei of hepatocellular carcinoma cells
24943041 These findings indicated that the polymorphisms of CREM gene were associated with nonobstructive azoospermia in the Chinese population and low CREM expression might be involved in the pathogenesis of spermatogenesis maturation arrest.
24672804 Data suggest ICER/CREM plays seminal role in down-regulation of expression/secretion of insulin by pancreatic beta-cell as an adaptive response to factors that promote diabetes; inappropriate induction of ICER leads to beta-cell dysfunction. [REVIEW]
24667640 CaMK4-dependent activation of AKT/mTOR and CREM-alpha underlies autoimmunity-associated Th17 imbalance.
24297179 CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a.
24100545 In Alzheimer's brain, we found an increased cellular expression of CREM in dentate gyrus neurons as compared to normal aging brains.
24047902 transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B.
23929392 Data suggest that cyclic AMP response element modulator-1 (CREM-1) might play an important role in the regulation of tumor metastasis and invasion and serve as a tumor suppressor in esophageal squamous cell carcinoma (ESCC).
23124208 Increased CREMalpha binding to the Notch-1 promoter resulted in significantly reduced Notch-1 promoter activity and gene transcription.
23019580 Data indicate that CpG-DNA methylation and mRNA expression of CREM, IL2, and IL17A of systemic lupus erythematosus (SLE) T cells reflect the effector memory CD4+ T-cell phenotype.
22510021 CREM expression is increased in thyroid cancer tissue and may play a role in the downregulation of sodium iodide symporter expression in thyroid cancer acting at the transcriptional level
22386572 The results of this study suggested that the single nucleotide polymorphisms of CREM do not influence diagnosis and treatment response in patients with major depressive disorder and bipolar disorder.
22281835 Estrogen can modulate the expression of CREMalpha and lead to IL-2 suppression in human T lymphocytes, thus revealing a molecular link between hormones and the immune system in Systemic lupus erythematosus
22198373 scriptive Statement The rsults of this study suggested the lack of influence of SNPs under investigation in the present study on the susceptibility to schizophrenia and on the response to antipsychotics.
22184122 cAMP-responsive element modulator alpha (CREMalpha) suppresses IL-17F protein expression in T lymphocytes from patients with systemic lupus erythematosus (SLE).
22093963 Transcription factor CREM is an important regulator of atrial growth implicated in the development of atrial fibrillation.
22025620 cAMP-responsive element modulator (CREM)alpha protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus.
22019623 Common variants of the CREM gene are involved in the genetic component conferring general susceptibility to inflammatory bowel disease in the Tunisian population.
21998402 Impaired expression of ICER contributes to elevation in CREB target genes and, therefore, to the development of insulin resistance in obesity.
21976679 Data provide direct evidence that CREMalpha mediates silencing of the IL2 gene in SLE T cells though histone deacetylation and CpG-DNA methylation.
21953500 CREMalpha suppresses spleen tyrosine kinase expression in normal but not systemic lupus erythematosus T cells.
21767532 Phosphorylation of ICER on a discrete residue targeted ICER to be monoubiquitinated.
21757709 AP-1-dependent up-regulation of the P2 promoter, SLE T cells fail to further increase their basal CREM levels upon T cell activation due to a decreased content of the AP-1 family member c-Fos
21547497 Induction of ICER links oxidative stress to beta cell failure caused by oxidised LDL, and it can be effectively abrogated by antioxidant treatment.
21507395 Patients with two types of male factor infertility display an increased abnormal methylation of CREM compared with control subjects.
21325296 ICER mediates chemotherapy anticancer activity through DUSP1-p38 pathway activation and drives the cell program from survival to apoptosis
21097497 anscriptional activation of the cAMP-responsive modulator promoter in human T cells is regulated by protein phosphatase 2A-mediated dephosphorylation of SP-1 and reflects disease activity in patients with systemic lupus erythematosus.
20488182 Results indicate that SPAG8 acts as a regulator of ACT and plays an important role in CREM-ACT-mediated gene transcription during spermatogenesis.
20413592 DNA cytosine methylation in the bovine leukemia virus promoter has a role in direct inhibition of cAMP-responsive element (CRE)-binding protein/CRE modulator/activation transcription factor binding
20378615 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19531482 cAMP stringently regulates human cathelicidin antimicrobial peptide expression in the mucosal epithelial cells by activating cAMP-response element-binding protein, AP-1, and inducible cAMP early repressor
19434522 This review will bring together data on ICER and its functions in the brain, with a special emphasis on recent findings highlighting the involvement of ICER in the regulation of long-term plasticity underlying learning and memory. [REVIEW]
19299714 CREMalpha is an important negative regulator of costimulation and APC-dependent T cell function
18984674 Observational study of gene-disease association. (HuGE Navigator)
18922788 BDNF- and seizure-dependent phosphorylation of STAT3 cause the adenosine 3',5'-monophosphate (cAMP) response element-binding protein (CREB) family member ICER (inducible cAMP early repressor) to bind with phosphorylated CREB at the Gabra1:CRE site.
18784739 CREB/ICER expression needs to be considered a pathogenetic feature in leukemogenesis
18700132 CREM has a role in CYP1A1 induction through ligand-independent activation pathway of aryl hydrocarbon receptor in HepG2 cells
18202121 CREM is an essential regulator of NIS gene expression.
17712720 Transcription factors of the CREB/CREM/ATF family have a moderate effect on human MC2-R promoter activity, but seem to play a minor role in transmitting stimulation of the cAMP pathway to increased MC2-R expression.
17340624 Data show that inducible cAMP early repressor splice variants ICER I and IIgamma both repress transcription of c-fos and chromogranin A.
17332439 The positive-feedback loop described in this review is regulated by phosphodiesterase 3A and ICER and is pathologically important in adult hearts.
17211988 CREM-alpha mRNA levels were higher in T cells from patients with systemic lupus erythematosus than controls while CREB mRNA levels did not differ between the two groups
17056544 CREMalpha exerts its repressor activity by a mechanism that involves recruitment of HDAC1, increased deacetylation of histones, and repression of promoter activity.
16899810 functional analysis of isoforms from the testes
16894555 These results constitute the first demonstration of the transcriptional control of ATP1A4 gene expression by cAMP and by CREMtau, a transcription factor essential for male germ cell gene expression.
16893891 HNF4alpha, CREM, HNF1alpha, and C/EBPalpha have roles in transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine
16687568 The interaction between CREM and one haplotype of ACT (activator of CREM in the testis) was reduced by 45% in a yeast two-hybrid assay.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16143638 Screening of a substantial number of patients would be required to clarify whether observed combinations of genetic changes in the CREM gene might explain some forms of male infertility.
16103121 SRp40 regulates the switch in splicing from production of CREMtau(2)alpha to CREMalpha
16048633 CREM activator and repressor isoforms were found in all germ cell types, but not in Sertoli cells; data suggest a fine-tuning between CREM activator and repressor isoforms in normal germ cells that might be disturbed during impaired spermatogenesis
15841182 Results identify calcium/calmodulin-dependent kinase IV as being responsible for the increased expression of CREM and the decreased production of interleukin-2 in systemic lupus erythematosus T cells.
15691874 isoforms regulate discrete groups of genes in myometrium
15569686 that heart-directed expression of CREM-IbDeltaC-X leads to complex cardiac alterations, suggesting CREM as a central regulator of cardiac morphology, function, and gene expression
15474076 Lack of spermatid elongation was not due to defective CREM expression. Therefore, CREM did not play a pathogenetic role in the onset of SMA in humans.
15456763 down-regulation of CREMtau-mediated gene expression by GCNF
15225122 Sperm nucleus PHGPx expression is mediated by the transcription factor CREM-tau, which acts as a cis-acting element localized in the first intron of the PHGPx gene. [CREM-tau]
15048659 These findings provide little additional evidence for a susceptibility locus for panic disorder either within the CREM gene or in a nearby region of chromosome 10p11 in our sample
14754893 CREB-1/CREM-1 have roles as regulators of macrophage differentiation
14511788 expression of cAMP-responsive element modulator(CREM) activators is a prerequisite for normal spermatogenesis, and the lack of CREM activator expression results in male infertility
12626549 Direct binding of CREM to the CRE site of the IL-2 promoter endows CREM with a central role in repression of IL-2 gene expression: CREM binding promotes chromatin deacetylation, limits promoter accessibility and decreases its transcriptional activity.
12555239 Observational study of gene-disease association. (HuGE Navigator)
12397208 5'-RACE on human testis cDNA indicated that exon theta2 is > or = 113 bp in size. In-vitro translation of CREM-theta1 and CREM-theta2 splice variants cloned from human testis yielded full length proteins and also shorter repressor products
12370343 Increased expression of CREM in T cells from systemic lupus erythmatosus (SLE) patients results from increased transcriptional activity of the CREM gene, and its binding to IL-2 promoter is responsible for decreased production of IL-2 by SLE T cells.
11988318 review of CREM transcription factor involvement with spermatogenesis
10853989 Treatment of dopaminergic rat PC12 cells with HIV-1 Tat downregulates the expression of tyrosine hydroxylase (TH) by upregulating the expression of the inducible cAMP early repressor which in turn abrogates the transcription activity of the TH promoter
10660577 Treatment of dopaminergic rat PC12 cells with HIV-1 Tat downregulates the expression of tyrosine hydroxylase (TH) by upregulating the expression of the inducible cAMP early repressor which in turn abrogates the transcription activity of the TH promoter

AA Sequence

MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPA      1 - 70
VTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKI     71 - 140
LNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQAL    141 - 210
TMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQ    211 - 280
GVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELET    281 - 350
LKDICSPKTDY                                                               351 - 361
//

Text Mined References (109)

PMID Year Title
26601115 2015 Cyclic AMP-Responsive Element Modulator ? Polymorphisms Are Potential Genetic Risks for Systemic Lupus Erythematosus.
25401338 2014 Specific genomic and transcriptomic aberrations in tumors induced by partial hepatectomy of a chronically inflamed murine liver.
24943041 2014 CREM variants rs4934540 and rs2295415 conferred susceptibility to nonobstructive azoospermia risk in the Chinese population.
24672804 2014 Decompensation of ?-cells in diabetes: when pancreatic ?-cells are on ICE(R).
24667640 2014 CaMK4-dependent activation of AKT/mTOR and CREM-? underlies autoimmunity-associated Th17 imbalance.
24297179 2014 cAMP responsive element modulator (CREM) ? mediates chromatin remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells.
24100545 2013 Wide distribution of CREM immunoreactivity in adult and fetal human brain, with an increased expression in dentate gyrus neurons of Alzheimer's as compared to normal aging brains.
24047902 2013 cAMP-responsive element modulator ? (CREM?) trans-represses the transmembrane glycoprotein CD8 and contributes to the generation of CD3+CD4-CD8- T cells in health and disease.
23929392 2013 Low expression of cyclic AMP response element modulator-1 can increase the migration and invasion of esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23124208 2012 cAMP-responsive element modulator ? (CREM?) contributes to decreased Notch-1 expression in T cells from patients with active systemic lupus erythematosus (SLE).
23019580 2012 cAMP response element modulator ? controls IL2 and IL17A expression during CD4 lineage commitment and subset distribution in lupus.
22510021 2012 Cyclic AMP-response element modulator inhibits the promoter activity of the sodium iodide symporter gene in thyroid cancer cells.
22386572 2012 Case-control association study of 14 variants of CREB1, CREBBP and CREM on diagnosis and treatment outcome in major depressive disorder and bipolar disorder.
22281835 2012 Estrogen upregulates cyclic AMP response element modulator ? expression and downregulates interleukin-2 production by human T lymphocytes.
22198373 2012 Possible influence of CREB1, CREBBP and CREM variants on diagnosis and treatment outcome in patients with schizophrenia.
22184122 2012 cAMP-responsive element modulator ? (CREM?) suppresses IL-17F protein expression in T lymphocytes from patients with systemic lupus erythematosus (SLE).
22093963 2013 Overexpression of cAMP-response element modulator causes abnormal growth and development of the atrial myocardium resulting in a substrate for sustained atrial fibrillation in mice.
22025620 2011 cAMP-responsive element modulator (CREM)? protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus.
22019623 2011 The CREM gene is involved in genetic predisposition to inflammatory bowel disease in the Tunisian population.
21998402 2011 Impaired expression of the inducible cAMP early repressor accounts for sustained adipose CREB activity in obesity.
21976679 2011 cAMP-responsive element modulator (CREM)? protein signaling mediates epigenetic remodeling of the human interleukin-2 gene: implications in systemic lupus erythematosus.
21953500 2012 CREM? suppresses spleen tyrosine kinase expression in normal but not systemic lupus erythematosus T cells.
21767532 2011 Evidence that phosphorylation by the mitotic kinase Cdk1 promotes ICER monoubiquitination and nuclear delocalization.
21757709 2011 A novel intronic cAMP response element modulator (CREM) promoter is regulated by activator protein-1 (AP-1) and accounts for altered activation-induced CREM expression in T cells from patients with systemic lupus erythematosus.
21547497 2011 Role for inducible cAMP early repressor in promoting pancreatic beta cell dysfunction evoked by oxidative stress in human and rat islets.
21507395 2011 Abnormal methylation of the promoter of CREM is broadly associated with male factor infertility and poor sperm quality but is improved in sperm selected by density gradient centrifugation.
21325296 2011 ICER evokes Dusp1-p38 pathway enhancing chemotherapy sensitivity in myeloid leukemia.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21097497 2011 Transcriptional activation of the cAMP-responsive modulator promoter in human T cells is regulated by protein phosphatase 2A-mediated dephosphorylation of SP-1 and reflects disease activity in patients with systemic lupus erythematosus.
20488182 2010 Sperm associated antigen 8 (SPAG8), a novel regulator of activator of CREM in testis during spermatogenesis.
20413592 2010 DNA cytosine methylation in the bovine leukemia virus promoter is associated with latency in a lymphoma-derived B-cell line: potential involvement of direct inhibition of cAMP-responsive element (CRE)-binding protein/CRE modulator/activation transcription factor binding.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19531482 2009 cAMP stringently regulates human cathelicidin antimicrobial peptide expression in the mucosal epithelial cells by activating cAMP-response element-binding protein, AP-1, and inducible cAMP early repressor.
19434522 2009 Inducible cAMP early repressor (ICER) and brain functions.
19299714 2009 The cyclic AMP response element modulator {alpha} suppresses CD86 expression and APC function.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
18922788 2008 BDNF selectively regulates GABAA receptor transcription by activation of the JAK/STAT pathway.
18784739 2008 ICER expression inhibits leukemia phenotype and controls tumor progression.
18700132 2008 Involvement of CREM in CYP1A1 induction through ligand-independent activation pathway of aryl hydrocarbon receptor in HepG2 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18202121 2008 Identification of cyclic adenosine 3',5'-monophosphate response element modulator as an activator of the human sodium/iodide symporter upstream enhancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17712720 2007 Regulation of human MC2-R gene expression by CREB, CREM, and ICER in the adrenocortical cell line Y1.
17340624 2007 Inducible cAMP early repressor splice variants ICER I and IIgamma both repress transcription of c-fos and chromogranin A.
17332439 2007 Regulation of phosphodiesterase 3 and inducible cAMP early repressor in the heart.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17211988 2006 CAMP response element modulator a expression in patients with systemic lupus erythematosus.
17056544 2006 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity.
16899810 Functional characterization of male germ cell-specific CREM isoforms.
16894555 2006 The transcription factor CREMtau and cAMP regulate promoter activity of the Na,K-ATPase alpha4 isoform.
16893891 2006 Transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine. Role of HNF4alpha, CREM, HNF1alpha, and C/EBPalpha.
16687568 2006 Sequencing and haplotype analysis of the activator of CREM in the testis (ACT) gene in populations of fertile and infertile males.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16143638 2005 Combinations of genetic changes in the human cAMP-responsive element modulator gene: a clue towards understanding some forms of male infertility?
16103121 2005 The switch in alternative splicing of cyclic AMP-response element modulator protein CREM{tau}2{alpha} (activator) to CREM{alpha} (repressor) in human myometrial cells is mediated by SRp40.
16048633 2005 CREM activator and repressor isoform expression in human male germ cells.
15841182 2005 Systemic lupus erythematosus serum IgG increases CREM binding to the IL-2 promoter and suppresses IL-2 production through CaMKIV.
15691874 2005 Identification of human myometrial target genes of the cAMP pathway: the role of cAMP-response element binding (CREB) and modulator (CREMalpha and CREMtau2alpha) proteins.
15569686 2005 Heart-directed expression of a human cardiac isoform of cAMP-response element modulator in transgenic mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474076 2004 Normal expression of isoforms activating cyclic adenosine monophosphate responsive element modulator in patients with spermatid maturation arrest.
15456763 2004 Germ cell nuclear factor relieves cAMP-response element modulator tau-mediated activation of the testis-specific promoter of human mitochondrial glycerol-3-phosphate dehydrogenase.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15225122 2004 cAMP-response element modulator-tau activates a distinct promoter element for the expression of the phospholipid hydroperoxide/sperm nucleus glutathione peroxidase gene.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15048659 2004 Investigation of polymorphisms in the CREM gene in panic disorder.
14754893 2004 PE-1/METS, an antiproliferative Ets repressor factor, is induced by CREB-1/CREM-1 during macrophage differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14511788 2003 Different CREM-isoform gene expression between equine and human normal and impaired spermatogenesis.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12626549 2003 The cyclic adenosine 5'-monophosphate response element modulator suppresses IL-2 production in stimulated T cells by a chromatin-dependent mechanism.
12555239 2003 Human nuclear transcription factor gene CREM: genomic organization, mutation screening, and association analysis in panic disorder.
12554693 2003 Novel regulation of cardiac force-frequency relation by CREM (cAMP response element modulator).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397208 2002 Novel leader exons of the cyclic adenosine 3',5'-monophosphate response element modulator (CREM) gene, transcribed from promoters P3 and P4, are highly testis-specific in primates.
12370343 2002 Antisense cyclic adenosine 5'-monophosphate response element modulator up-regulates IL-2 in T cells from patients with systemic lupus erythematosus.
12198160 2002 Ca2+-dependent block of CREB-CBP transcription by repressor DREAM.
11988318 2002 The expanding family of CREB/CREM transcription factors that are involved with spermatogenesis.
11701720 2001 Variable expression of the transcription factors cAMP response element-binding protein and inducible cAMP early repressor in the normal adrenal cortex and in adrenocortical adenomas and carcinomas.
11094064 2000 DREAM-alphaCREM interaction via leucine-charged domains derepresses downstream regulatory element-dependent transcription.
11053263 2000 Characterization of gene expression in human trabecular meshwork using single-pass sequencing of 1060 clones.
11044457 2000 CREM activator and repressor isoforms in human testis: sequence variations and inaccurate splicing during impaired spermatogenesis.
10853989 2000 Extracellular HIV-1 Tat protein activates the transcriptional repressor inducible cAMP early repressor in both the Jurkat cell line and primary peripheral blood mononuclear cells.
10660577 2000 HIV-1 Tat-mediated inhibition of the tyrosine hydroxylase gene expression in dopaminergic neuronal cells.
10409662 1999 The cyclic AMP response element modulator family regulates the insulin gene transcription by interacting with transcription factor IID.
10373550 1999 Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis.
10086359 1999 CBP-independent activation of CREM and CREB by the LIM-only protein ACT.
9737722 1998 Identification and expression of a novel isoform of cAMP response element modulator in the human heart.
9510963 1998 Deoxyribonucleic acid-protein interactions and expression of the human testis-specific lactate dehydrogenase promoter: transcription factor Sp1 plays a major role.
9006899 1997 Differential activation of viral and cellular promoters by human T-cell lymphotropic virus-1 tax and cAMP-responsive element modulator isoforms.
8994192 1997 Human endometrial stromal cells express novel isoforms of the transcriptional modulator CREM and up-regulate ICER in the course of decidualization.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8622971 1996 cAMP inducibility of transcriptional repressor ICER in developing and mature human T lymphocytes.
8600391 1996 Severe impairment of spermatogenesis in mice lacking the CREM gene.
8600390 1996 Spermiogenesis deficiency and germ-cell apoptosis in CREM-mutant mice.
8549766 1995 Modulation of Tax and PKA-mediated expression of HTLV-I promoter via cAMP response element binding and modulator proteins CREB and CREM.
8404858 1993 Multiple and cooperative phosphorylation events regulate the CREM activator function.
8206879 1994 Novel isoforms of human cyclic AMP-responsive element modulator (hCREM) mRNA.
7916662 1993 Human CREM gene: evolutionary conservation, chromosomal localization, and inducibility of the transcript.
7809053 1994 An isoform of transcription factor CREM expressed during spermatogenesis lacks the phosphorylation domain and represses cAMP-induced transcription.
7730336 1995 Activating transcription factor 1 and cyclic AMP response element modulator can modulate the activity of the immunoglobulin kappa 3' enhancer.
1461747 1992 Cyclic AMP response element binding protein CREB and modulator protein CREM are products of distinct genes.