Property Summary

NCBI Gene PubMed Count 106
PubMed Score 917.33
PubTator Score 510.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -2.065 1.5e-08
astrocytic glioma -2.100 2.8e-02
chronic rhinosinusitis -1.203 4.7e-03
colon cancer -1.300 1.8e-02
cutaneous lupus erythematosus 1.200 1.9e-03
gastric carcinoma 1.300 2.7e-02
group 4 medulloblastoma -1.200 3.5e-03
hepatocellular carcinoma -1.200 2.8e-05
interstitial cystitis 1.100 2.0e-03
intraductal papillary-mucinous carcinoma... -1.300 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
invasive ductal carcinoma 1.700 1.4e-02
lung adenocarcinoma -1.002 7.9e-07
lung cancer -1.300 7.6e-03
medulloblastoma, large-cell -2.300 1.4e-04
non-small cell lung cancer -1.059 1.4e-10
oligodendroglioma -1.200 4.9e-02
osteosarcoma 1.147 7.0e-03
ovarian cancer 1.400 1.6e-02
pancreatic cancer -1.100 3.1e-03
pancreatic carcinoma -1.100 3.1e-03
pancreatic ductal adenocarcinoma liver m... -1.100 3.1e-02
pituitary cancer -1.500 1.1e-05
tuberculosis -3.400 1.4e-05
ulcerative colitis 1.500 3.1e-06

Gene RIF (73)

AA Sequence

MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPA      1 - 70
VTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKI     71 - 140
LNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQAL    141 - 210
TMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQ    211 - 280
GVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELET    281 - 350
LKDICSPKTDY                                                               351 - 361
//

Text Mined References (113)

PMID Year Title