Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.300 3.1e-02
astrocytic glioma -2.700 3.7e-03
Astrocytoma, Pilocytic -3.200 4.3e-05
atypical teratoid / rhabdoid tumor -3.400 4.0e-07
ependymoma -3.300 1.8e-03
glioblastoma -2.800 9.3e-07
group 3 medulloblastoma -3.400 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.8e-02
medulloblastoma, large-cell -3.500 3.2e-03
oligodendroglioma -2.400 1.1e-02
ovarian cancer -1.700 2.1e-07
primitive neuroectodermal tumor -2.900 4.7e-03

Gene RIF (1)

AA Sequence

MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIW      1 - 70
QQSFPASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLA     71 - 140
TVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDP    141 - 210
EDPRCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISRE    211 - 280
EYFKAVPRKA                                                                281 - 290
//

Text Mined References (4)

PMID Year Title