Property Summary

NCBI Gene PubMed Count 33
PubMed Score 113.90
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.009 2.3e-04
malignant mesothelioma -1.600 2.5e-07
acute quadriplegic myopathy 1.526 1.3e-05
Atopic dermatitis -1.100 1.4e-04
adrenocortical carcinoma -1.224 1.5e-04
diabetes mellitus -1.200 9.6e-03
ovarian cancer 1.900 1.2e-04

Gene RIF (20)

PMID Text
26722374 These results indicate that CREG1 is a down-stream effector of KRAS in a sub-type of non-small cell lung cancer cells and a novel candidate biomarker or therapeutic target for KRAS mutant non-small cell lung cancer.
24896341 Results indicate that cellular repressor of E1A-stimulated gene 1 protein (CREG1) increases endothelial cell (EC) filopodia formation.
24018888 The results suggest a novel role of CREG to promote HUVEC proliferation through the ERK/cyclin E signaling pathway.
23580165 CREG can inhibit NF-kappaB activation, TNF-alpha-induced inflammatory responses and the hyperpermeability of endothelial cells.
23518389 miR-31 not only directly binds to its target gene CREG and modulates the vascular smooth muscle cells(VSMC) phenotype through this interaction, but also can be an important biomarker in diseases involving VSMC phenotypic modulation.
23040447 Suggest that CREG is a novel adventitial fibroblast phenotypic modulator in a p38MAPK-dependent manner.
21939655 Upregulation of CREG expression induced HUVEC migration.
21872252 CREG plays a critical role in protecting the vascular endothelium from apoptosis, and the protective effort of CREG against ECs apoptosis is through the activation of the VEGF/PI3K/AKT signaling pathway
21263217 Cooperation of CREG1 and p16 (INK4a) inhibits the expression of cyclin A and cyclin B by inhibiting promoter activity thereby decreasing mRNA and protein levels; these proteins are required for S-phase entry and G2/M transition.
21195083 Data suggest that soluble CREG protein can exert its biological function via glycosylation-independent binding to the extracellular domains 11-13 of cell surface M6P/IGF2R, modulating SMC phenotypic switching from contractile to proliferative.
20951690 no ssociation between common variants of CREG and coronary artery disease in the northern Chinese Han population
20951690 Observational study of gene-disease association. (HuGE Navigator)
20060003 CREG plays a key role in modulating VSMC apoptosis through the p38 and JNK signal transduction pathways, both in vitro and in s
19769965 CREG plays a critical role in the inhibition of SMC migration, as well as maintaining SMCs in a mature phenotype
19536175 Observational study of gene-disease association. (HuGE Navigator)
19413895 The expression of CREG improves cardiac functions and inhibits cardiac hypertrophy, inflammation and fibrosis through blocking MEK-ERK1/2-dependent signalling.
19064610 Observational study of gene-disease association. (HuGE Navigator)
18472385 We demonstrate that CREG is expressed in the vascular endothelium; data suggests that CREG differentially regulates the growth of the denuded artery wall and smooth vascular muscle cell.
18267954 CREG promotes a mature smooth muscle cell phenotype and reduces neointimal formation in balloon-injured rat carotid artery.
16344469 putative flavin mononucleotide-binding pocket in CREG is sterically blocked by a loop and several key bulky residues

AA Sequence

MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA      1 - 70
LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF     71 - 140
DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT    141 - 210
PEEYYNVTVQ                                                                211 - 220
//

Text Mined References (35)

PMID Year Title
26722374 2016 Glycoproteomic Approach Identifies KRAS as a Positive Regulator of CREG1 in Non-small Cell Lung Cancer Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24896341 2014 CREG1 promotes angiogenesis and neovascularization.
24018888 2013 CREG promotes the proliferation of human umbilical vein endothelial cells through the ERK/cyclin E signaling pathway.
23580165 2013 Cellular repressor of E1A stimulated genes enhances endothelial monolayer integrity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23518389 2013 MicroRNA-31 controls phenotypic modulation of human vascular smooth muscle cells by regulating its target gene cellular repressor of E1A-stimulated genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23040447 2012 Cellular repressor E1A-stimulated genes controls phenotypic switching of adventitial fibroblasts by blocking p38MAPK activation.
21939655 2011 Cellular repressor of E1A-stimulated genes regulates vascular endothelial cell migration by the ILK/AKT/mTOR/VEGF(165) signaling pathway.
21872252 2011 Overexpression of CREG attenuates atherosclerotic endothelium apoptosis via VEGF/PI3K/AKT pathway.
21263217 2011 CREG1 enhances p16(INK4a) -induced cellular senescence.
21195083 2011 Glycosylation-independent binding to extracellular domains 11-13 of mannose-6-phosphate/insulin-like growth factor-2 receptor mediates the effects of soluble CREG on the phenotypic modulation of vascular smooth muscle cells.
20951690 2011 Lack of association between cellular repressor of E1A-stimulated genes (CREG) [corrected] polymorphisms and coronary artery disease in the Han population of North China.
20060003 2010 Cellular repressor of E1A-stimulated genes inhibits human vascular smooth muscle cell apoptosis via blocking P38/JNK MAP kinase activation.
19769965 2009 CREG inhibits migration of human vascular smooth muscle cells by mediating IGF-II endocytosis.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19413895 2009 Cellular repressor of E1A-stimulated genes attenuates cardiac hypertrophy and fibrosis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18472385 2008 Adenovirus-mediated intra-arterial delivery of cellular repressor of E1A-stimulated genes inhibits neointima formation in rabbits after balloon injury.
18267954 2008 CREG promotes a mature smooth muscle cell phenotype and reduces neointimal formation in balloon-injured rat carotid artery.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344469 2005 The crystal structure of CREG, a secreted glycoprotein involved in cellular growth and differentiation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12934103 2003 The secreted glycoprotein CREG inhibits cell growth dependent on the mannose-6-phosphate/insulin-like growth factor II receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
10815803 2000 The secreted glycoprotein CREG enhances differentiation of NTERA-2 human embryonal carcinoma cells.
9710587 1998 A cellular repressor of E1A-stimulated genes that inhibits activation by E2F.