Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.81
PubTator Score 21.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 4.4e-04
osteosarcoma -1.799 2.1e-04
sonic hedgehog group medulloblastoma 1.600 3.5e-03
atypical teratoid / rhabdoid tumor -1.500 1.2e-03
glioblastoma -1.800 2.0e-04
medulloblastoma, large-cell -1.600 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-03
lung cancer 1.200 1.3e-03
pediatric high grade glioma -1.300 1.5e-03
lung adenocarcinoma 1.514 1.8e-07
Pick disease -2.500 8.8e-07
progressive supranuclear palsy -2.200 6.1e-03
ovarian cancer -1.800 7.9e-06

Synonym

Accession Q9NS37 B2R8Q9 Q0P5U9 Q52LT3
Symbols ZF
SMILE

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (17)

PMID Text
24265317 Results indicate that Ursodeoxycholic acid (UDCA) activates SMILE gene expression, which leads to repression of liver X receptor alpha (LXRalpha)-mediated hepatic lipogenic enzyme gene expression.
24200963 Zhangfei/CREBZF stabilizes p53 and co-localizes with it in cellular nuclei; the bLZip domain of Zhangfei is required for its profound effects on cell growth and interaction with p53.
24155933 Zhangfei had a suppressive effect on most unfolded protein response genes.
22983008 The transcription factor CREBZF is a novel positive regulator of p53.
22798206 Our objective was to determine the molecular mechanisms by which Zhangfei influences medulloblastoma cell lines
22707059 CREBZF, a novel Smad8-binding protein.
22134986 a microarray study of SMILE knock-down and PMA activation in HeLa cells was compared to earlier analysis based on microarray data of kidney allograft tolerance and rejection to determine possible new genes and gene networks involved in kidney transplantation
21994947 the curcumin/LKB1/AMPK/SMILE/PGC1alpha pathway differentially regulates ER stress-mediated gene transcription
21603654 SMILE is involved in the endoplasmic reticulum stress response, by modulating proteasome activity and XBP-1 transcript expression. This function of SMILE may influence immune cell behavior in the context of transplantation.
19690166 SMILE is a novel corepressor of ERRgamma, and SIRT1 has a role as a novel repressive mechanism for SMILE and ERRgamma inverse agonist
19016376 In differentiated PC12 cells, Zhangfei activated the trkA promoter and induced the expression of endogenous trkA.
18719857 findings showed Zhangfei activated the expression of trkA and Egr1 in medulloblastoma cells and caused these cells to display markers of apoptosis
18719857 Zhangfei causes medulloblastoma cells to undergo apoptosis
18657049 These results indicate that SMILE isoforms regulate the inhibition of estrogen receptor transactivation by SHP in a cell-type-specific manner and act as a novel transcriptional co-regulator in ER signalling.
16343488 ZF binds ATF4/CREB2 and enhances its response to MEK1 activation.
16282471 ZF suppresses the ability of VP16 to activate herpes simplex virus IE gene expression
15705566 ZF suppresses the ability of Luman/CREB3 to activate gene expression

AA Sequence

MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSR      1 - 70
GGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSG     71 - 140
GLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSP    141 - 210
RKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARL    211 - 280
LSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASS    281 - 350
SLKM                                                                      351 - 354
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24265317 2014 Ursodeoxycholic acid inhibits liver X receptor ?-mediated hepatic lipogenesis via induction of the nuclear corepressor SMILE.
24200963 2014 Effects of cyclic AMP response element binding protein-Zhangfei (CREBZF) on the unfolded protein response and cell growth are exerted through the tumor suppressor p53.
24155933 2013 Zhangfei/CREB-ZF - a potential regulator of the unfolded protein response.
22983008 2012 The transcription factor CREBZF is a novel positive regulator of p53.
22798206 2012 Mechanism for the induction of cell death in ONS-76 medulloblastoma cells by Zhangfei/CREB-ZF.
22707059 2012 CREBZF, a novel Smad8-binding protein.
22134986 2012 SMILE silencing and PMA activation gene networks in HeLa cells: comparison with kidney transplantation gene networks.
21994947 2011 Curcumin differentially regulates endoplasmic reticulum stress through transcriptional corepressor SMILE (small heterodimer partner-interacting leucine zipper protein)-mediated inhibition of CREBH (cAMP responsive element-binding protein H).
21603654 2011 The involvement of SMILE/TMTC3 in endoplasmic reticulum stress response.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19690166 2009 Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation.
19016376 2008 Zhangfei, a novel regulator of the human nerve growth factor receptor, trkA.
18719857 2009 Zhangfei induces the expression of the nerve growth factor receptor, trkA, in medulloblastoma cells and causes their differentiation or apoptosis.
18657049 2008 SMILE, a new orphan nuclear receptor SHP-interacting protein, regulates SHP-repressed estrogen receptor transactivation.
18391022 2008 A novel protein, Luman/CREB3 recruitment factor, inhibits Luman activation of the unfolded protein response.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16343488 2006 Cooperative interaction of Zhangfei and ATF4 in transactivation of the cyclic AMP response element.
16282471 2005 The neuronal host cell factor-binding protein Zhangfei inhibits herpes simplex virus replication.
15705566 2005 Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235138 2002 Interaction of HCF-1 with a cellular nuclear export factor.
10871379 2000 Zhangfei: a second cellular protein interacts with herpes simplex virus accessory factor HCF in a manner similar to Luman and VP16.