Property Summary

NCBI Gene PubMed Count 26
PubMed Score 10.91
PubTator Score 21.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.2e-03
gastric cancer 1.200 4.4e-04
glioblastoma -1.800 2.0e-04
group 3 medulloblastoma 1.300 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-03
lung adenocarcinoma 1.514 1.8e-07
lung cancer 1.200 1.3e-03
medulloblastoma, large-cell -1.600 2.3e-04
osteosarcoma 1.649 2.0e-03
ovarian cancer -1.700 3.5e-04
pediatric high grade glioma -1.300 1.5e-03
Pick disease -1.500 9.7e-07
progressive supranuclear palsy -1.400 2.8e-03

Gene RIF (17)

AA Sequence

MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSR      1 - 70
GGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSG     71 - 140
GLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSP    141 - 210
RKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARL    211 - 280
LSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASS    281 - 350
SLKM                                                                      351 - 354
//

Text Mined References (29)

PMID Year Title