Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.02
PubTator Score 183.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 2.100 3.5e-02
hepatocellular carcinoma -1.200 8.8e-05
osteosarcoma 1.676 7.3e-05
glioblastoma -1.900 2.8e-04
atypical teratoid / rhabdoid tumor -2.100 7.5e-06
medulloblastoma, large-cell -2.700 1.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.003 1.4e-02
juvenile dermatomyositis 1.446 7.5e-10
acute quadriplegic myopathy 1.310 8.5e-04
tuberculosis and treatment for 6 months 1.500 2.6e-05
non-small cell lung cancer -1.712 1.8e-23
adult high grade glioma -1.600 1.3e-03
lung adenocarcinoma -1.200 2.1e-10
psoriasis -1.400 9.9e-13
breast carcinoma -1.100 1.5e-22
spina bifida -2.630 2.3e-02
Pick disease 1.500 8.6e-07
Breast cancer -1.300 3.8e-09
ductal carcinoma in situ -1.100 2.1e-04
invasive ductal carcinoma -2.100 9.7e-04
acute myeloid leukemia 1.400 8.9e-03
ulcerative colitis -1.400 9.2e-05
ovarian cancer -2.100 2.9e-09

AA Sequence

MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFLSLEDCKDIEN      1 - 70
LESFTDVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLA     71 - 140
QLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKITSRAAAPVCSSKTLQAEVPLSDCVQKASKPTSS    141 - 210
TQIMVKTNMYHNEKVNFHVECKDYVKKAKVKINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGME    211 - 280
PLQGHATPALPFKETQELLLSPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPT    281 - 350
KCSPEEDEEDEEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEV    351 - 420
TSISSRKRGKRRYFWEYSEQLTPSQQERMLRPSEWNRDTLPSNMYQKNGLHHGKYAVKKSRRTDVEDLTP    421 - 490
NPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRLKKKAQYEANKVKLWGLNTEY    491 - 560
DNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDTLGLPVAGQTSEFVNQVLEKTAEGNPTGGLV    561 - 630
GLRIPTSKV                                                                 631 - 639
//

Text Mined References (8)

PMID Year Title
23071095 2012 Luman/CREB3 recruitment factor regulates glucocorticoid receptor activity and is essential for prolactin-mediated maternal instinct.
18391022 2008 A novel protein, Luman/CREB3 recruitment factor, inhibits Luman activation of the unfolded protein response.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.