Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.31
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Rheumatoid Arthritis 2.600 1.8e-02
gastric cancer 1.200 7.9e-04
hepatocellular carcinoma 1.700 3.6e-05
pancreatic cancer 2.600 4.2e-05
astrocytic glioma 1.100 1.3e-02
cutaneous lupus erythematosus -1.100 2.0e-02
psoriasis -1.900 3.6e-04
osteosarcoma -1.604 1.9e-02
glioblastoma 1.600 3.0e-05
group 4 medulloblastoma -2.900 1.9e-05
medulloblastoma, large-cell -1.300 2.8e-02
Atopic dermatitis -1.100 8.4e-03
tuberculosis 4.000 1.7e-08
non-small cell lung cancer -1.091 2.8e-10
intraductal papillary-mucinous carcinoma... -1.200 3.3e-02
lung cancer -1.400 3.1e-04
breast carcinoma -1.200 1.1e-16
pediatric high grade glioma 1.400 1.9e-03
non primary Sjogren syndrome sicca -1.100 1.7e-02
pancreatic carcinoma 2.600 4.2e-05
acute myeloid leukemia -1.600 2.6e-02
lung carcinoma -1.900 8.4e-20
Pick disease -1.400 4.1e-03
progressive supranuclear palsy -2.000 1.3e-02
Breast cancer -2.600 5.4e-13
ductal carcinoma in situ -1.600 1.4e-02
invasive ductal carcinoma -2.600 5.5e-03
ovarian cancer -1.500 4.0e-03

Protein-protein Interaction (5)

Gene RIF (5)

PMID Text
25076032 CREB5 accelerate the metastasis of colorectal cancer by regulating these five key genes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE      1 - 70
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS     71 - 140
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG    141 - 210
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ    211 - 280
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM    281 - 350
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE    351 - 420
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG    421 - 490
SSTLSQLTTHRTDLNPIL                                                        491 - 508
//

Text Mined References (25)

PMID Year Title
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
25076032 2014 Involvement of the CREB5 regulatory network in colorectal cancer metastasis.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9847074 1998 Toward a complete human genome sequence.
8440710 1993 Isolation and characterization of a novel member of the gene family encoding the cAMP response element-binding protein CRE-BP1.
8378084 1993 Regulation of trans-activating capacity of CRE-BPa by phorbol ester tumor promoter TPA.