Property Summary

NCBI Gene PubMed Count 26
PubMed Score 7.80
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia -1.600 2.6e-02
adult high grade glioma 1.300 2.0e-02
astrocytic glioma 1.100 1.3e-02
Atopic dermatitis -1.100 8.4e-03
Breast cancer -1.300 1.4e-10
breast carcinoma -1.100 9.0e-06
cutaneous lupus erythematosus -1.100 2.0e-02
ductal carcinoma in situ -1.200 1.6e-02
gastric cancer 1.200 7.9e-04
glioblastoma 1.100 1.7e-03
group 3 medulloblastoma -1.700 5.5e-03
hepatocellular carcinoma 1.700 3.6e-05
intraductal papillary-mucinous carcinoma... -1.200 3.3e-02
invasive ductal carcinoma -1.800 1.7e-02
lung cancer -1.300 1.2e-02
lung carcinoma -1.900 8.4e-20
medulloblastoma, large-cell -1.300 2.8e-02
non primary Sjogren syndrome sicca -1.100 1.7e-02
non-small cell lung cancer -1.091 2.8e-10
osteosarcoma -1.604 1.9e-02
ovarian cancer -1.500 4.0e-03
pancreatic cancer 2.000 1.4e-03
pancreatic carcinoma 2.000 1.4e-03
Pick disease -1.400 4.1e-03
progressive supranuclear palsy -2.000 1.3e-02
psoriasis -1.900 3.6e-04
Rheumatoid arthritis 2.600 1.8e-02
tuberculosis 3.600 2.7e-08

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE      1 - 70
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS     71 - 140
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG    141 - 210
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ    211 - 280
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM    281 - 350
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE    351 - 420
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG    421 - 490
SSTLSQLTTHRTDLNPIL                                                        491 - 508
//

Text Mined References (29)

PMID Year Title