Property Summary

NCBI Gene PubMed Count 17
PubMed Score 296.89
PubTator Score 26.62

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
chronic lymphocytic leukemia 2.467 6.7e-05
Multiple myeloma 1.045 4.3e-02
glioblastoma 1.600 1.8e-03
astrocytoma 2.600 2.1e-03
atypical teratoid / rhabdoid tumor 1.400 1.2e-03
lung cancer -1.200 4.6e-02
active Crohn's disease 1.047 1.4e-02
pediatric high grade glioma 1.400 1.8e-05
sonic hedgehog group medulloblastoma 1.400 1.5e-05
pilocytic astrocytoma 1.900 9.0e-10
posterior fossa group A ependymoma 1.200 1.6e-08
subependymal giant cell astrocytoma 1.830 1.9e-02
lung adenocarcinoma 1.017 1.9e-04
ulcerative colitis 1.700 1.2e-07
ovarian cancer -2.400 1.3e-09

Gene RIF (14)

PMID Text
25955804 These data suggest that the secreted luminal BBF2H7 C-terminus is involved in Hedgehog ligand-dependent cancer cell proliferation through activation of Hedgehog signaling. BBF2H7 C-terminus may be a novel target for the development of anticancer drugs.
23955342 Fbxw7 controls osteogenesis and chondrogenesis by targeting OASIS and BBF2H7, respectively, for degradation.
22495181 the BBF2H7-mediated Sec23A pathway is required for ER-to-Golgi procollagen trafficking to promote collagen synthesis
21536545 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 The human Creb3L2 can activate SPCG transcription in a heterologous system(Drosophila embryos), which suggests a general and direct role for this family of bZip transcription factors in mediating high-level secretory capacity.
20878102 We characterized a widely expressed transcript of CREB3L2 generated by an intronic polyadenylation site in intron 4 of the gene.
20471519 Fusion of the FUS and CREB3L2 genes in a supernumerary ring chromosome is associated with low-grade fibromyxoid sarcoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19212619 We characterized the promoter region of CREB3L2, showing that it is asymmetrically bidirectional
18757431 findings identify a novel CREB3L2-PPARgamma gene fusion mutation in thyroid carcinoma and reveal a thyroid signaling pathway that is regulated by intramembrane proteolysis and disrupted in cancer
17721195 Presence of FUS/CREB3L2 and FUS/CREB3L1 in low-grade fibromyxoid sarcoma and sclerosing epithelioid fibrosarcoma suggests these neoplasms may be related.
17178827 BBF2H7, a novel transmembrane bZIP transcription factor, is a new type of endoplasmic reticulumm stress transducer.
17117415 CREB3L2 is not only structurally, but also functionally very similar to CREB3L1.
12915480 BBF2H7 was fused with FUS in a low grade myxoid liposarcoma.

AA Sequence

MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP      1 - 70
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVP     71 - 140
SVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSH    141 - 210
GSDSEGSLSPNPRLHPFSLPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYP    211 - 280
IPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTL    281 - 350
LQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT    351 - 420
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLL    421 - 490
ELQQHLVSAKLEGNETLKVVELDRRVNTTF                                            491 - 520
//

Text Mined References (27)

PMID Year Title
25955804 2015 Promotion of Cancer Cell Proliferation by Cleaved and Secreted Luminal Domains of ER Stress Transducer BBF2H7.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23955342 2013 F-box and WD repeat domain-containing-7 (Fbxw7) protein targets endoplasmic reticulum-anchored osteogenic and chondrogenic transcriptional factors for degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705851 2012 Activation of OASIS family, ER stress transducers, is dependent on its stabilization.
22495181 2012 BBF2H7-mediated Sec23A pathway is required for endoplasmic reticulum-to-Golgi trafficking in dermal fibroblasts to promote collagen synthesis.
21536545 2011 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 2010 The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity.
20878102 2010 Characterization of an alternative transcript of the human CREB3L2 gene.
20471519 2010 Fusion of the FUS and CREB3L2 genes in a supernumerary ring chromosome in low-grade fibromyxoid sarcoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19212619 2009 Characterization of the human CREB3L2 gene promoter.
18757431 2008 CREB3L2-PPARgamma fusion mutation identifies a thyroid signaling pathway regulated by intramembrane proteolysis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17721195 2007 Translocation-positive low-grade fibromyxoid sarcoma: clinicopathologic and molecular analysis of a series expanding the morphologic spectrum and suggesting potential relationship to sclerosing epithelioid fibrosarcoma: a study from the French Sarcoma Group.
17178827 2007 BBF2H7, a novel transmembrane bZIP transcription factor, is a new type of endoplasmic reticulum stress transducer.
17117415 2007 Characterization of the native CREB3L2 transcription factor and the FUS/CREB3L2 chimera.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15139001 2004 The chimeric FUS/CREB3l2 gene is specific for low-grade fibromyxoid sarcoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12915480 2003 Fusion of the FUS and BBF2H7 genes in low grade fibromyxoid sarcoma.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.