Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.34
PubTator Score 414.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma 2.000 1.8e-02
psoriasis -2.000 2.1e-04
osteosarcoma 1.788 4.0e-02
pancreatic ductal adenocarcinoma liver m... 1.600 1.5e-02
lung cancer -1.800 5.4e-05
active ulcerative colitis 1.568 8.6e-04
group 3 medulloblastoma -1.100 2.0e-02
pilocytic astrocytoma 1.300 4.1e-05
Polycystic Ovary Syndrome -1.220 1.0e-02
Breast cancer 1.300 1.2e-06
pituitary cancer -1.200 4.7e-04

Protein-protein Interaction (6)

Gene RIF (22)

PMID Text
26810754 Our data further strengthens the role for CREB3L1 as a metastasis suppressor in breast cancer and demonstrates that epigenetic silencing is a major regulator of the loss of CREB3L1 expression
26110425 CREB3L1 was expressed in 19% of RCC, which is generally resistant to doxorubicin, but in 70% of diffuse large B-cell lymphoma that is sensitive to doxorubicin.
25625847 CREB3L1 mRNA expression is downregulated in human bladder cancer.CREB3L1 is epigenetically silenced in human bladder cancer facilitating tumor cell spreading and migration in vitro.
25353281 Case Reports: genetically confirmed primary renal sclerosing epithelioid fibrosarcoma with EWSR1-CREB3L1 gene fusion.
25310401 Cleavage of CREB3L1 releases its NH2-terminal domain from membranes, allowing it to enter the nucleus where it binds to Smad4 to activate transcription of genes encoding proteins required for assembly of collagen-containing extracellular matrix.
24896634 Case Report: low-grade fibromyxoid sarcoma of the kidney found to harbor the EWSR1-CREB3L1 gene fusion.
24441665 EWSR1-CREB3L1 gene fusions are predominant over FUS and CREB3L2 rearrangements in pure sclerosing epithelioid fibrosarcoma.
24242870 Temporally regulates the differentiation from neural precursor cells into astrocytes [review]
24126059 CREB3L1 plays an important role in suppressing tumorigenesis and that loss of expression is required for the development of a metastatic phenotype.
23955342 Fbxw7 controls osteogenesis and chondrogenesis by targeting OASIS and BBF2H7, respectively, for degradation.
23588368 We report 2 cases of Low-grade fibromyxoid sarcoma serendipitously found to harbor a novel alternative EWSR1-CREB3L1 gene fusion.
23383089 a novel regulatory mechanism for VEGFA transcription by OASIS in human retinal pigment epithelial cells
23335989 OASIS is important for the ER stress response and maintenance of some extracellular matrix proteins in human glioma cells.
23256041 CREB3L1 expression may be a useful biomarker in identifying cancer cells sensitive to doxorubicin.
22705851 OASIS is notably unstable proteins that are easily degraded via the ubiquitin-proteasome pathway under normal conditions.
21987447 Rapid amplification of cDNA ends revealed exon 6 of the cAMP-responsive element binding protein 3-like 1 gene (CREB3L1) fused in-frame to the EWSR1 exon 11.
21767813 CREB3L1 may play an important role in limiting virus spread by inhibiting proliferation of virus-infected cells.
21767813 Upon infection with diverse DNA and RNA viruses, CREB3L1 was proteolytically cleaved, allowing its NH(2) terminus to enter the nucleus and induce multiple genes encoding inhibitors of the cell cycle to block cell proliferation of infected cells.
21536545 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 The human Creb3L1 can activate SPCG transcription in a heterologous system(Drosophila embryos), which suggests a general and direct role for this family of bZip transcription factors in mediating high-level secretory capacity.
17721195 Presence of FUS/CREB3L2 and FUS/CREB3L1 in low-grade fibromyxoid sarcoma and sclerosing epithelioid fibrosarcoma suggests these neoplasms may be related.
12054625 a transcriptional activator of CREB/ATF family with a transmembrane domain

AA Sequence

MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPL      1 - 70
LDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQEQSPELPVDP     71 - 140
LAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTPPS    141 - 210
SHGSDSDGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTK    211 - 280
LPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQL    281 - 350
QKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM    351 - 420
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDG    421 - 490
GNGTSPDFSHSKEWFHDRDLGPNTTIKLS                                             491 - 519
//

Text Mined References (34)

PMID Year Title
27499293 2016 Inverting the Topology of a Transmembrane Protein by Regulating the Translocation of the First Transmembrane Helix.
26810754 2016 Epigenetic silencing of CREB3L1 by DNA methylation is associated with high-grade metastatic breast cancers with poor prognosis and is prevalent in triple negative breast cancers.
26110425 2015 Identification of CREB3L1 as a Biomarker Predicting Doxorubicin Treatment Outcome.
25625847 2014 OASIS/CREB3L1 is epigenetically silenced in human bladder cancer facilitating tumor cell spreading and migration in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
25353281 2015 Primary renal sclerosing epithelioid fibrosarcoma: report of 2 cases with EWSR1-CREB3L1 gene fusion.
25310401 2014 Sustained induction of collagen synthesis by TGF-? requires regulated intramembrane proteolysis of CREB3L1.
24896634 Primary low-grade fibromyxoid sarcoma of the kidney in a child with the alternative EWSR1-CREB3L1 gene fusion.
24441665 2014 Recurrent EWSR1-CREB3L1 gene fusions in sclerosing epithelioid fibrosarcoma.
24242870 2014 Physiological functions of endoplasmic reticulum stress transducer OASIS in central nervous system.
24126059 2013 CREB3L1 is a metastasis suppressor that represses expression of genes regulating metastasis, invasion, and angiogenesis.
24079343 2013 Deficiency for the ER-stress transducer OASIS causes severe recessive osteogenesis imperfecta in humans.
23955342 2013 F-box and WD repeat domain-containing-7 (Fbxw7) protein targets endoplasmic reticulum-anchored osteogenic and chondrogenic transcriptional factors for degradation.
23588368 2013 EWSR1-CREB3L1 gene fusion: a novel alternative molecular aberration of low-grade fibromyxoid sarcoma.
23383089 2013 Transcriptional regulation of VEGFA by the endoplasmic reticulum stress transducer OASIS in ARPE-19 cells.
23335989 2013 OASIS/CREB3L1 is induced by endoplasmic reticulum stress in human glioma cell lines and contributes to the unfolded protein response, extracellular matrix production and cell migration.
23256041 2012 Doxorubicin blocks proliferation of cancer cells through proteolytic activation of CREB3L1.
22705851 2012 Activation of OASIS family, ER stress transducers, is dependent on its stabilization.
21987447 2011 A novel EWSR1-CREB3L1 fusion transcript in a case of small cell osteosarcoma.
21767813 2011 The membrane-bound transcription factor CREB3L1 is activated in response to virus infection to inhibit proliferation of virus-infected cells.
21536545 2011 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 2010 The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity.
17721195 2007 Translocation-positive low-grade fibromyxoid sarcoma: clinicopathologic and molecular analysis of a series expanding the morphologic spectrum and suggesting potential relationship to sclerosing epithelioid fibrosarcoma: a study from the French Sarcoma Group.
16417584 2006 Cleavage of the membrane-bound transcription factor OASIS in response to endoplasmic reticulum stress.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236796 2006 CREB4, a transmembrane bZip transcription factor and potential new substrate for regulation and cleavage by S1P.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054625 2002 OASIS is a transcriptional activator of CREB/ATF family with a transmembrane domain.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.