Property Summary

NCBI Gene PubMed Count 35
PubMed Score 41.97
PubTator Score 34.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.4e-05
psoriasis 6685 8.1e-05
osteosarcoma 7933 4.1e-04
Disease Target Count Z-score Confidence
Hypertrophy of breast 20 3.187 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.700 8.1e-05
osteosarcoma 1.111 4.1e-04
ovarian cancer 1.400 3.4e-05

 MGI Phenotype (1)

Gene RIF (25)

PMID Text
25358080 INHA gene expression is upregulated by cAMP via CRE in human trophoblasts, and TFAP2 regulates this expression by interacting with CRE.
25077563 human sLZIP plays a critical role in development of atherosclerosis and can be used as a therapeutic target molecule for treatment of atherosclerosis
24481121 These results indicate that sLZIP plays a role in expression of c-Jun, and migration and invasion of cervical cancer cells via regulation of MMP-9 transcription.
24441043 Findings indicate that sLZIP negatively regulates AR transactivation in androgen-dependent PCa cells and functions as a positive regulator in tumor progression of androgen-independent PCa. sLZIP contributes to the malignant phenotype of PCa.
24185178 A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity.
23583719 propose that JAB1 is a novel binding partner of Luman, which negatively regulates the activity of Luman by promoting its degradation
23079381 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
23077317 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
23023215 GSK3beta was downregulate in all samples and CREB3 did not show a significant decrease or increase in its mRNA expression, but the results were significant in mucoepidermoid carcinoma and salivary duct carcinoma.
22009750 sLZIP plays a critical role in MMP-9 expression and is probably involved in invasion and metastasis of cervical cancer
22004728 sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration.
20546900 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation.
20473547 These findings suggest that HDAC3 selectively represses CREB3-mediated transcriptional activation and chemotactic signalling in human metastatic breast cancer cells.
19779205 sLZIP functions as a negative regulator in glucocorticoid-induced transcriptional activation of GR by recruitment and activation of HDACs
19460752 Knockdown of cAMP responsive element binding protein 3 (CREB3; LZIP) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18391022 Luman/CREB3 recruitment factor inhibits Luman activation of the unfolded protein response
18189280 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17296613 factor NF-kappaB plays an important role in regulation of LZIP expression, and LZIP expression regulates the monocyte cell migration induced by Lkn-1
17192849 LZIP functions as a positive regulator in the NF-kappaB activation pathway that is triggered by Lkn-1 without affecting the transcriptional activation of NF-kappaB induced by other CCR1-dependent chemokines
17054986 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
16940180 Results report the identification of Herp, a gene involved in ER stress-associated protein degradation (ERAD), as a direct target of Luman.
15705566 the host cell factor-binding transcription factor Luman is inhibited by Zhangfei
15001559 LZIP binds to CCR1 and the interaction between CCR1 and LZIP participates in regulation of Lkn-1-dependent cell migration without affecting the chemotactic activities of other CC chemokines that bind to CCR1.
12271126 HCF-1 contains an activation domain (HCF-1(AD)) required for maximal transactivation by VP16 and its cellular counterpart LZIP.
12138176 Data show that Luman is processed by regulated intramembrane proteolysis. The site 1 protease (S1P), a Golgi-resident enzyme, may be involved in the processing of Luman.

AA Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSS      1 - 70
NPCLVHHDHTYSLPRETVSMDLGECEISLTGRTGFMGLAIHTFPFAESESCRKEGTQMTPQHMEELAEQE     71 - 140
IARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYT    141 - 210
AQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLP    211 - 280
AEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLE    281 - 350
WPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG                             351 - 395
//

Text Mined References (39)

PMID Year Title
25358080 2014 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25077563 2014 Human sLZIP promotes atherosclerosis via MMP-9 transcription and vascular smooth muscle cell migration.
24481121 2014 The role of sLZIP in transcriptional regulation of c-Jun and involvement in migration and invasion of cervical cancer cells.
24441043 2015 The role of sLZIP in cyclin D3-mediated negative regulation of androgen receptor transactivation and its involvement in prostate cancer.
24185178 2013 A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
23583719 2013 JAB1/CSN5 inhibits the activity of Luman/CREB3 by promoting its degradation.
23023215 2012 GSK3? and CREB3 gene expression profiling in benign and malignant salivary gland tumors.
22009750 2011 Human leucine zipper protein sLZIP induces migration and invasion of cervical cancer cells via expression of matrix metalloproteinase-9.
22004728 2012 Regulation of ADP-ribosylation factor 4 expression by small leucine zipper protein and involvement in breast cancer cell migration.
20546900 2010 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation.
20473547 2010 HDAC3 selectively represses CREB3-mediated transcription and migration of metastatic breast cancer cells.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20141198 2010 Sustained rolling of microparticles in shear flow over an electrostatically patchy surface.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20091349 2010 Cell death of chondrocytes is a combination between apoptosis and autophagy during the pathogenesis of Osteoarthritis within an experimental model.
19779205 2009 A novel isoform of human LZIP negatively regulates the transactivation of the glucocorticoid receptor.
18587271 2008 Human LZIP induces monocyte CC chemokine receptor 2 expression leading to enhancement of monocyte chemoattractant protein 1/CCL2-induced cell migration.
18391022 2008 A novel protein, Luman/CREB3 recruitment factor, inhibits Luman activation of the unfolded protein response.
18189280 2008 Lithium response and genetic variation in the CREB family of genes.
17296613 2007 Regulation of human LZIP expression by NF-kappaB and its involvement in monocyte cell migration induced by Lkn-1.
17192849 2007 Role of human LZIP in differential activation of the NF-kappaB pathway that is induced by CCR1-dependent chemokines.
17054986 2006 Luman, a new partner of HIV-1 TMgp41, interferes with Tat-mediated transcription of the HIV-1 LTR.
16940180 2006 Luman/CREB3 induces transcription of the endoplasmic reticulum (ER) stress response protein Herp through an ER stress response element.
16236796 2006 CREB4, a transmembrane bZip transcription factor and potential new substrate for regulation and cleavage by S1P.
15845366 2005 Luman is capable of binding and activating transcription from the unfolded protein response element.
15705566 2005 Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15001559 2004 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271126 2002 An activation domain in the C-terminal subunit of HCF-1 is important for transactivation by VP16 and LZIP.
12138176 2002 Luman, the cellular counterpart of herpes simplex virus VP16, is processed by regulated intramembrane proteolysis.
10984507 2000 N-terminal transcriptional activation domain of LZIP comprises two LxxLL motifs and the host cell factor-1 binding motif.
10871379 2000 Zhangfei: a second cellular protein interacts with herpes simplex virus accessory factor HCF in a manner similar to Luman and VP16.
10675342 2000 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation.
10629049 2000 Mutations in host cell factor 1 separate its role in cell proliferation from recruitment of VP16 and LZIP.
10623756 2000 Potential role for luman, the cellular homologue of herpes simplex virus VP16 (alpha gene trans-inducing factor), in herpesvirus latency.
9389645 1997 Viral mimicry: common mode of association with HCF by VP16 and the cellular protein LZIP.
9271389 1997 Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor.