Property Summary

NCBI Gene PubMed Count 464
PubMed Score 3764.11
PubTator Score 1826.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.200 1.9e-03
osteosarcoma 1.766 6.3e-08
ependymoma 1.400 6.2e-06
group 4 medulloblastoma 2.200 5.0e-05
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
glioblastoma 1.200 1.2e-02
medulloblastoma, large-cell 1.500 1.1e-04
primitive neuroectodermal tumor 1.500 4.2e-06
ulcerative colitis -1.131 4.7e-02
juvenile dermatomyositis 1.083 3.0e-13
pediatric high grade glioma 1.100 1.6e-02
primary Sjogren syndrome 1.100 3.6e-05
Pick disease 1.100 8.0e-05
ovarian cancer -1.200 1.1e-04
Gaucher disease type 3 -1.100 2.7e-03

Gene RIF (402)

PMID Text
27049759 demonstrated that GSK-3alpha is regulated by CREB in lung cancer and is required for the cell viability. These findings implicate CREB-GSK-3alpha axis as a novel therapeutic target for lung cancer treatment
26996991 miR-124 suppresses seizure activity and regulates CREB1 activity. (Review)
26823765 C/EBPalpha inhibited breast cancer cell growth via a novel miR-134/CREB signaling pathway.
26757817 Both OGG1 and UNG2 impede CREB1 from binding to a binding site consensus sequence (CRE)substrate when the CRE site contains the specific DNA lesion recognized by each glycosylase.
26755589 TRAF3 regulates B-cell survival via inhibition of CREB stability
26669856 MyD88s is positively regulated by IKKbeta and CREB and negatively regulated by ERK1/2 signaling pathways.
26655813 Taken together, we conclude that CREB protects tumor cells from gamma-irradiation, and combination of CREB inhibition plus ionizing radiation will be a promising radiotherapeutic approach.
26649298 PFOS may inhibit BDNF-ERK-CREB signalling by increasing miR-22 levels, which may, in part, explain the mechanism of PFOS neurotoxicity
26642955 This study demonstrates a new role for CREB as a regulator of ER stress, which is required to properly respond to stressful conditions, such as hypoxia.
26626456 Anxiety disorder comorbidity was the stronger predictor of current suicide risk and significant associations were found with variations in rs13515 (MAPK1) and rs6740584 (CREB1) polymorphisms.
26617801 miR-506 significantly decreased the expression and transcription activity CREB1 to inhibit esophageal squamous carcinoma cell proliferation.
26610485 CREB plays an important role in the inhibition of IGF2R expression by binding to the IGF2R promoter and further suppresses H9c2 cardiomyoblast cell apoptosis induced by IGF2R signaling under hypoxic conditions.
26573110 the early induction and activation of NF-kappaB1 in Ramos cells could mediate necrotic cell death and be linked to other molecules belonging to CREB family and involved in the cell cycle regulation.
26546821 CREB enhances KLF4 up-regulatory effect on apoE promoter.
26474850 Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1
26472185 serum starvation induces CREB1 expression, in turn activating miR-320a expression, which then down-regulates VDAC1 expression to facilitate mitophagy
26398148 CREB is a negative regulator of the TNFAIP1 gene.
26352206 Activation of the cAMP/PKA/CREB pathway plays a key role in NAM-induced Sirt1 upregulation.
26348925 CREB1 is phosphorylated following activation of ESR1 by estradiol.
26294214 Aki1 silencing decreased cell viability and caused cell-cycle arrest of multiple DMM cell lines via effects on the PKA-CREB1 signaling pathway. Blocking CREB activity phenocopied Aki1 silencing.
26279447 LF triggered CREB1 phosphorylation in IL-1beta-induced Human articular chondrocytes apoptosis through AKT1 signaling.
26263387 Novel Epigenetic CREB-miR-630 Signaling Axis Regulates Radiosensitivity in Colorectal Cancer
26245996 High expression of ROR1 (63%), pAkt (36%), and pCREB (20%) was observed in gastric adenocarcinomas, and expression of these proteins was well intercorrelated.
26185160 GABPalpha Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1
26124005 These results demonstrated that the inhibitory effects of resveratrol on MDR1 expression in HCT116/L-OHP cells were closely associated with the inhibition of NF-kappaB signaling and CREB activation in an AMPK-dependent manner.
26109721 KSHV activates the MSK1/2-CREB1 pathway during primary infection and that it depends on this pathway for viral lytic replication. I
26036429 Our results demonstrate that CREB is proto-oncogene, and the phosphorylated level of CREB at Ser 133 site influences the growth and metastatic activity of renal cancer
26025137 Its transcription is down regulated by amyloid beta protein.
26008971 Data indicate an important role for cyclic-AMP responsive element binding protein 1 (CREB) transcription factor in the survival of acute lymphoblastic leukemia (ALL) cells and as a potential target for treatment.
25951193 ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase.
25940704 exogenous expression of the cAMP responsive element binding protein 1 gene in different UBUC-derived cell lines induced EMP2 transcription and subsequent translation.
25939814 Results suggest that genetic variations in CREB-BDNF and other pathways partially explain the variance of precuneus reactivity to alcohol cues which appears to be associated with alcohol use disorder severity
25936964 Hepatitis B virus core protein activates Enhancer I through its binding to cAMP response element (CRE), increasing the concurrent accumulation of CREB/CBP on CRE, and thus increases CRE transcriptional activation.
25936754 CREB activation is essential for EGF-induced SGLT1 gene expression.
25934695 CREB plays a key role in the K-RAS(V12)-mediated neoplastic phenotype and represents a suitable therapeutic target for murine and human K-RAS(V12)-induced tumors
25883219 PKCepsilon-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25847246 Nicotine (a major component of tobacco) treatment significantly up-regulated MMP7 expression due to enhanced CREB phosphorylation followed by its nuclear translocation in gastric adenocarcinoma cells.
25843777 CREB is a key negative regulator of CA9 in gastric cancer. Over-expression of CREB can significantly repress the expression of CA9.
25825983 CREB1 was highly expressed and correlated with lymph node metastasis, distant metastasis and tumor stage and poor outcome in gastric cancer.
25814225 Transient reduction of CREB activity might play a role in the pathophysiology of acute coronary syndrome.
25809782 Mechanistically, MEF-2 was recruited to the viral promoter (LTR, long terminal repeat) in the context of chromatin, and constituted Tax/CREB transcriptional complex via direct binding to the HTLV-1 LTR.
25808826 EMSA and ChIP assay confirmed the direct binding of activated CREB to the CREB binding site of 5' SPHK2 promoter region
25755794 37, 95% CI = 3.02-23.23; OR = 7.84, 95% CI = 2.93-20.98 for rs2551941). We also noted that CREB polymorphisms combined with family harmony and childhood trauma conferred increased susceptibility for major depressive disorder
25707758 CBP and p300 as lysine acetyltransferases responsible for the regulation of MR
25648114 These data indicate that miR-1224-5p may inhibit tumor-associated activity in malignant gliomas by targeting CREB1.
25625293 The results of the present study indicated that CHCHD2 may be a novel biomarker for hepatocellular carcinoma and that CREB is important in the transcriptional activation of CHCHD2 by HCV NS2.
25615818 CREB silencing using RNA interference reduced basal levels of BCRP mRNA and diminished the induction of BCRP by EGF. Chromatin immunoprecipitation assays confirmed that a putative CRE site on the BCRP promoter bound p-CREB by a point mutation
25607216 PKA/CREB is involved in the regulation of constitutive promoter activity of the USP22 gene.
25605016 Upregulation of miR-328 and inhibition of CREB-DNA-binding activity are critical for resveratrol-mediated suppression of MMP-2 and subsequent metastatic ability in human osteosarcomas.
25563814 High phosphorylated cyclic AMP responsive element binding protein expression is associated with angiogenesis and recurrence in meningioma.
25541153 High CREB1 expression is associated with neoplastic myelopoiesis.
25528004 The binding of CREB to the promoter region, -216 to +115, enhanced IA-2 transcription by more than fivefold.
25476123 astrocytomas and oligodendrogliomas are characterized by distinctive patterns of p-CREB expression
25382680 CaSR-mediated increase in [Ca2+]i probably modulates cytoskeleton organization and gene expression via transcription factor CREB
25348080 The kinetics and energetics of a disordered protein domain the kinase-inducible domain (KID) of the transcription factor CREB and that of its phosphorylated form pKID, were determined.
25319707 Activation of CREB overexpressing neurons impaired consolidation of cocaine memory.
25277212 FAK/CREB/TNNC1 has a role in mediating the effect of stromal MFAP5 on ovarian cancer metastatic potential
25277185 studies discovered that HMGB1 suppressed phosphorylation, nuclear translocation, and activation of CREB, by inhibiting nuclear translocation of PKA catalytic subunit
25175744 FUR transcription is activated by CREB-dependent stimulation of the FUR P1 promoter during human trophoblast syncytialization.
25150575 It is associated with episodic memory performance.
25111229 CREB is involved in the regulation of MM pathogenesis by regulation of inflammation.
25109834 PKA phosphorylation of CREB was involved in the EP4 receptor-mediated PGE2 upregulation of c-Myc in hepatocellular carcinoma.
25099937 PGC-1alpha promoter activity and transcription was dramatically repressed in neuronal cells when exposed to ethanol, suggesting that ethanol blunts cAMP-->CREB signaling pathway to interfere with the transcription of PGC-1alpha.
25084773 Active CREB1 promotes a malignant TGFbeta2 autocrine loop in glioblastoma.
25071166 the CRTC1/MAML2 transcriptional signature predicts other malignancies having combined involvement of MYC and CREB
25043418 Data showed an association of a rare CREB1 haplotype CCGGC with schizophrenia.
25033730 Both miR-200b and CREB-1 may play important cooperative roles in the progression of human astrocytoma.
24966904 Migration of CD166 positive progenitor cells to sites of cartilage damage may be directed by regulation of DCC/CREB signaling.
24955721 Neither single-marker nor haplotypic association were found between suicide risk and/or a personal history of suicide attempt with any of the investigated SNPs after multiple testing correction
24836190 Aromatase expression is up-regulated in tamoxifen-resistant breast cancer via PI3K/Akt-dependent CREB activation.
24833716 SH3TC2 is regulated by the transcription factors CREB and SOX10, define a regulatory SNP at this disease-associated locus and reveal SH3TC2 as a candidate modifier locus of CMT disease phenotypes.
24819468 Ras expression negatively regulated the TSH-stimulated CREB phosphorylation but was ineffective on forskolin-stimulated CREB phosphorylation
24796664 overexpression of sorcin increased the phosphorylation of CREB1 and the binding of CREB1 to the CRE sequence of mdr1/p-gp promoter, and induced the expression of MDR1/P-gp
24792438 Data suggest that MSK1 and MSK2 are the major CREB kinases in fibroblast-like synoviocytes from rheumatoid arthritis patients stimulated with lysophosphatidic acid and that phosphorylation of CREB1 at Ser-133 plays a significant role in IL-8 production.
24781730 Endothelial cells from aging individuals have impaired angiogenesis and reduced expression of VEGF likely due to impaired nuclear transport of P-STAT3 and P-CREB transcription factors in these cells.
24774361 Activated CREB reduced smooth muscle cell proliferation from atherosclerotic plaques via p21-dependent mechanism.
24743054 Authors conclude therefore that ETs upregulate MCAM in an Akt and ERK/MEK-dependent, but CREB-independent manner, providing an understanding for possible pharmacologic intervention in progressing melanoma.
24704376 One SNP in exon 3, rs35349697, demonstrated a significant correlation with opioid and alcohol addiction. A novel SNP, also located in exon 3, showed epistatic interaction with rs35349697 to decrease susceptibility to narcotic addiction.
24655565 we find that CD44, which is involved in mesothelioma cells migration, was modulated by exemestane via cAMP and pCREB
24627100 visfatin modulates glucose production in HepG2 cells through the PKA/CREB pathway, rather than via SIRT1 signaling.
24598141 transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH
24489003 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
24488767 Data show that CREB phosphorylation is regulated by FTO.
24366569 PF-3758309 suppresses CREB, NF-kappaB, and beta-catenin pathways.
24338025 Sp1 may regulate the expression of CD59, whereas CREB-binding protein (CBP)/p300 bridge NF-kappaB and CREB, which functions as an enhancer-binding protein to induce the up-regulation of CD59 during in lipopolysaccharide (LPS)-triggered complement activation.
24334212 Associations were confirmed between AD and platelet GSK3beta activity, lymphocyte CREB activity and plasma BDNF. CREB activity and platelet BDNF concentration seems to be related to depressive disorder.
24316029 Authors show that overexpression of CREB1 potently blocked major immediate-early gene transcription and human cytomegalovirus replication.
24289115 Long non-coding RNA DQ786243 can be related with severity of Crohn's disease. It can affect the expression of CREB and Foxp3 through which regulates the function of regulatory T cells. CREB itself seems not the mediator of DQ786243 to up-regulate Foxp3.
24257117 The results point at CREB as a positive regulator of SOX3 gene transcription in NT2/D1 cells, while its contribution to RA induction of SOX3 promoter is not prominent.
24244341 These findings suggest that Ang II may activate multiple signaling pathways involving p38 MAPK leading to the activation of NF-kappaB and CREB, which feed back to upregulate the AT1R gene.
24233491 Suggest cross-talk between angiogenesis and inflammation and demonstrate a crucial role of CREB activation in the modulation of the VEGFR2-mediated proinflammatory/proangiogenic response of endothelial cells to gremlin.
24085294 protein effectors of the RSK2-CREB-Fascin-1 pathway represent promising biomarkers and therapeutic targets in the clinical prognosis and treatment of metastatic human cancers.
24065533 The results suggested that HBZ suppressed cyclin D1 transcription through interactions with CREB.
24055910 CREB is a critical signaling node in Lysophosphatidic acid-Lysophosphatidic acid receptor and Galpha12/gep proto-oncogene stimulated oncogenic signaling in ovarian cancer cells.
24041570 This study shows roles for NF-kappaB and CREB to regulate Hspa1a expression and a coordinated action by several transcription factors for Hspa1a transactivation under heat-shock/ischemia-like conditions.
24025972 CREB plays an important role in the HER-2/neu-mediated transformation by altering in vitro and in vivo growth characteristics suggesting that it could be a potential target for cancer therapy.
23979134 A miR-433 seed match region in human and mouse CREB1 3'-UTRs, was identified.
23896026 acidotic pH through inhibition of CREB activation inhibits protein synthesis and ultimately unfolded protein response activated apoptotic signals
23894352 a novel regulatory mechanism of hepatic bile acid metabolism by alcohol via Cb1r-mediated activation of Crebh
23857777 ZIP4 activates the zinc-dependent transcription factor CREB and requires this transcription factor to increase miR-373 expression through the regulation of its promoter.
23844928 This study demonistrated that there was an effect of CREB1 polymorphism on selective attention and retrieval of long-term memory, but not on immediate memory.
23838680 These results permit to hypothesize that CREB is involved in pterygium pathogenesis.
23814058 CDK1-dependent phosphorylation of CREB on Ser-270/Ser-271 facilitates its dissociation from chromatin during mitosis by reducing its intrinsic DNA binding potential.
23727510 CREB protein is required for activation of the small conductance Ca2+-activated K+ channel protein (SK)3 channel in neuroblastoma cells.
23708553 the BMP pathway is involved in calcitonin gene-related peptide-induced osteogenic differentiation but not in proliferation, whereas the cAMP/pCREB pathway is involved in the expression of BMP-2.
23619509 The effects of genetic variation at the BDNF-related loci neurotrophic tyrosine kinase receptor 2, CREB1, and CREB binding protein, in response to the antidepressants paroxetine and mirtazapine in geriatric patients with major depression, were examined.
23568192 This study demonstrated that the regional prevalence of the CREB1 risk alleles in Europeans is likely caused by genetic hitchhiking due to natural selection acting on a nearby gene.
23543137 MiR-200b targets the CREB1 gene and suppresses glioma cell growth.
23537502 Present results suggest that some genetic polymorphisms in both CREB1 and MAPK1 could be associated with treatment remission.
23532963 Mutual interaction between YAP and CREB promotes tumorigenesis in liver cancer.
23526216 CREB1 silencing attenuates nickel- and PGE2-stimulated release of IL-8 from human lung fibroblasts.
23504989 CREB is necessary for specific maintenance of the GluA1 subunit within the post-synaptic densities of hippocampal neurons.
23494562 PGE2-enhanced MMP2 expression is mediated through EP1 receptors and calcium signaling pathway-induced CREB phosphorylation in human cholangiocarcinoma cells.
23469012 study identified the core promoter region responsible for constitutive expression of LAPTM4B and clarified that CREB1 played an important role in LAPTM4B transcriptional regulation in human breast cancer cells
23462962 cAMP response element-binding protein (CREB) downregulates GRIP1 and is necessary for the PKA-stimulated degradation of GRIP1, which leads to changes in the expression of a subset of genes regulated by estrogen receptor-alpha in MCF-7 breast cancer cells.
23417028 We identified CREB and Egr-1 as being significantly deficient in juvenile myelomonocytic leukemia.
23403511 Data indicate that pretreatment with the MEK/ERK inhibitor U0126 prevented the rapamycin-induced increases in pCREB, Bcl-2, and VEGF-A expression.
23382855 Substitution of any of the TFBS from our particular search of MEF2, CREB and SRF significantly decreased the number of identified clusters
23297769 Data suggest that GSK3 (glycogen synthase kinase 3) signaling regulates TGFb1- (transforming growth factor beta 1-) induced myofibroblast differentiation by up-regulating CREB1 (cAMP responsive element binding protein 1) phosphorylation/activation.
23220172 We conclude that the effects of selenoprotein H on mitochondrial biogenesis and mitochondrial function are probably mediated through protein kinase A-CREB-PGC-1alpha and Akt/protein kinase B-CREB-PGC-1alpha pathways.
23213254 Mechanism of CREB recognition and coactivation by the CREB-regulated transcriptional coactivator CRTC2
23195957 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein
23185366 CREB-miR-9 negative feedback minicircuitry coordinates the migration and proliferation of glioma cells
23168992 Copy number variation upstream of CREB1 was associated with Alzheimer disease.
23143030 results provide evidence that the constitutively phosphorylated transcription factor CREB is involved in the biomineralization process of adult human molar odontoblasts and cementoblasts
23127979 Identified CREB activators MAPKAPK3 and FHL5 as mediators of intimal hyperplasia in vein graft samples.
23100280 Data suggest that microRNA-34b controls CREB expression and contributes to myeloid transformation from both healthy bone marrow and myelodysplastic syndromes.
23086924 Ischemia insult triggered by oxygen-glucose deprivation (OGD) enhances NRSF mRNA levels and then NRSF antagonizes the CREB signaling on CART activation, leading to augmented cell death.
23055509 Epileptic brain regions prone to seizures show persistent activation of CREB.
23049845 CaMK4 regulates beta-cell proliferation and apoptosis in a CREB-dependent manner and CaMK4-induced IRS-2 expression is important in these processes
23038261 the Rit-p38-MSK1/2 signaling pathway may have an important role in the stress-dependent regulation of CREB-dependent gene expression.
23032945 It is well established that cyclic adenosine monophosphate (cAMP) signaling regulates behavior.
23020846 GLP-1 induces CREB-regulated brain-derived neurotrophic factor (BDNF) promoter through multiple signaling pathways. GLP-1 is able to protect neurons from amyloid beta-induced apoptosis.
23019365 CREB promotes gliomagenesis and acts as a modulator of oncogenic mir-23a, which represses the tumor suppressor PTEN.
23011268 Reduced levels of CREB in the nucleus accumbus correlate social anhedonia with molecular and cellular features as biomarkers related to depression and the DISC1 pathway.
22922957 Extracellular acidosis induces Ca(2+) oscillation via NHE1, leading to Ca(2+)/CaMKII-dependent CREB activation in human central nervous system pericytes.
22743041 By increasing MKP-1 expression via parallel p38 MAPK- and CREB-mediated pathways, S1P temporally regulates MAPK signaling pathways by upregulating the negative feedback controller MKP-1.
22726539 We highlight the importance of the CREB/HMGA2 pathway in malignant transformation associated with mitochondrial dysfunction
22669896 genistein may play a beneficial role in vascular function through targeting the PKA/CREB/eNOS/NO signaling pathway
22627767 Sox4 and CREB cooperate and contribute to increased proliferation of hematopoietic progenitor cells.
22609331 The effect of norepinephrine on amyloid beta(1-42) peptide-induced responses in migroglia-like THP-1 cells is contingent on cyclic AMP/protein kinase (PK)A pathways and cAMP responsive element binding protein (CREB) activation.
22574704 A significant interaction shows that CREB1 rs4675690 polymorphism modulates the effect of childhood sexual abuse on adulthood anger-trait levels.
22570239 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferation
22561749 Data show that the cAMP/PKA/CREB signaling pathway initiates acidosis-induced V-ATPase trafficking in salivary ducts via regulation of Rab11b expression.
22539488 miR-181b may function as a tumor suppressor in gastric adenocarcinoma cells through negative regulation of CREB1
22510762 Review: discuss clinicopathologic and molecular features of group of neoplasms unified by the presence of EWSR1-CREB1 and EWSR1-ATF1 genetic fusions.
22505473 identified CREB as the regulating factor able to only bind to the MMP13 promoter when the -104 CpG is demethylated
22469229 CREB1 is necessary for gamma-globin induction in K562 cells, a role that may be mediated in part through the upregulation of gamma-globin expression by hydroxyurea in K562 cells.
22386572 The results of this study suggested that the single nucleotide polymorphisms of CREB1 do not influence diagnosis and treatment response in patients with major depressive disorder and bipolar disorder.
22383952 Sp1, CREB, HNF-1, and NF-Y, known to be responsive to hormones and diet, regulate NAGS transcription
22349818 studies identify a tripartite Akt-regulated phosphorylation mechanism that functions to hamper normal ERbeta activity and turnover through the concerted actions of CBP and Mdm2 in response to growth factor signaling pathways in breast cancer cells.
22325466 These results indicate that miR-182 targets the CREB1 gene and suppresses gastric adenocarcinoma cell growth, suggesting that miR-182 shows tumor-suppressive activity in human gastric cancer.
22294156 results show that human tau protein may alter the GCs-mediated regulation of PKA activity and CREB phosphorylation
22293360 In this study, the genotype distributions and allele frequencies of CREB1 rs4675690 polymorphisms were examined in 267 Japanese healthy subjects
22285928 UCA1 regulated cell cycle through CREB via PI3K-AKT dependent pathway in bladder cancer.
22271686 Together, these findings reveal a CD44-CREB signaling pathway that is needed to sustain cancer cell proliferation, potentially offering new molecular targets for therapeutic intervention in thyroid carcinoma.
22267179 A p.D116G mutation in CREB1 leads to novel multiple malformation syndrome resembling CrebA knockout mouse
22253425 Antiapoptotic actions of exendin-4 against hypoxia and cytokines are augmented by CREB
22219277 A crucial role is indicated for Rho signaling and CREB in modulation of nuclear localization of ZO-1 and maintaining the integrity of endothelial monolayers.
22219277 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
22198373 The rsults of this study suggested the lack of influence of SNPs under investigation in the present study on the susceptibility to schizophrenia and on the response to antipsychotics.
22185778 a previously undescribed role of Daxx in repressing cAMP-responsive gene expression and also a mechanism underlying the repressive effect of Daxx on CREB transcriptional potential
22180334 No evidence of insertions of targeting vector sequence was observed at regions other than the mouse Creb1 gene.
22127929 BRS-3 agonist-dependent signaling mediates CREB phosphorylation and transactivation through partially PKA, PKC, and mitogen-activated protein/extracellular regulated kinase kinase (MEK)-1 pathways.
22072831 These results suggest that transcription factors NF-kappaB and CREB are involved in IL-8 production in human neutrophils induced by stimulation with Trichomonas vaginalis infection.
22027994 Decreased endogenous NMNAT2 function caused by reduced CREB signaling during pathological insults may be one of underlying mechanisms for neuronal death in tauopathies
21998402 Impaired expression of ICER contributes to elevation in CREB target genes and, therefore, to the development of insulin resistance in obesity.
21997693 Describe primary pulmonary myxoid sarcoma with EWSR1-CREB1 gene fusion.
21956116 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
21832046 PGD(2) can induce MUC5B overproduction via ERK MAPK/RSK1/CREB signaling and that DP1 receptor may have suppressive effects in controlling MUC5B overproduction in the airway.
21816823 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
21784978 Constitutive CREB phosphorylation by exaggerated InsP(3)R Ca(2+) signaling in familial Alzheimer's disease (FAD) PS-expressing cells may represent a signaling pathway involved in the pathogenesis of AD.
21734652 Increasing CREB function in the CA1 region of dorsal hippocampus of transgenic TgCRND8 mice is sufficient to restore function in key hippocampal domains.
21706049 LYPD3 expression is regulated by LKB1-CRTC-CREB signaling axis
21705328 Dual function of protein kinase C (PKC) in TPA-induced MnSOD expression: activation of CREB and FOXO3a by PKC-alpha phosphorylation and by PKC-mediated inactivation of Akt, respectively.
21644508 Cystic fibrosis-related CREB regulation is mediated directly through transgenic beta-arrestin-2 expression via the MEK-ERK kinase signaling pathway.
21598377 we report construction of a mouse model of Major depressive disorder that carries the human pathogenic sequence at the homologous position of the mouse Creb1 promoter. The recombinant strain exhibited alterations in two standardized behavioral tests.
21497119 These data support the role of p38 MAPK/CREB1 signaling in Ggamma-globin gene transcription under steady-state conditions.
21483768 role of Toll like receptor (TLR)2 and selective early activation of the CREB pathway in the innate immune interactions between human DC and M. vaccae on DC-dependent T cell responses
21398611 Data demonstrate a key role for Mal in mediating TLR2 and TLR4 activation of CREB and induction of CREB-responsive genes including Il-10.
21325281 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21315782 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
21295542 CREB preferentially down-regulates MDM2 and thereby contributing to p53-mediated apoptosis in response to glucose deprivation.
21268077 Study observed that CREB was phosphorylated following transactivation of EGFR by c-Src in EV71-infected cells.
21215389 Genetic variation associated with reduced function in the CREB1-BDNF-NTRK2 pathway has multiple influences on risk mechanisms of depression, but almost all the single nucleotide polymorphisms studied amplified the effect of childhood adversity.
21172805 TOX3 induces transcription in neuron depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
21084670 This review summarizes the role of CREB, a key transcription factor that regulates diverse cellular responses, including proliferation, survival, and differentiation.
21079758 Data show that the binding rate between domains of CREB and CREB binding protein was initially accelerated and subsequently dramatically decreased as the strength of the nonnative hydrophobic interactions increased.
21075212 The present study delineates the fundamental elements of a core promoter structure that will be helpful for future studies regarding the regulation of RAB25 gene.
21044077 [review] CREB is a critical component of the neuroprotective transcriptional network. CREB dysregulation contributes to an array of neuropathological conditions.
21034562 Intracellular CMTM2 can negatively regulate HIV-1 transcription, at least in part, by targeting the AP-1 and CREB pathways.
21034562 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
20979795 Tuberculosis patients had diminished CREB protein levels, and reduced ability of binding to the IFN-gamma promoter.
20945072 Differential expression of CREB/ATF transcription factors could be observed on neurogenic induction, pointing to a decisive role of the cAMP-CREB/ATF system.
20943350 significant interaction between the TT genotype of rs2070995 (located in KCNJ6) and the GG genotype of rs2253206 (located in CREB1) on rumination were found
20943350 Observational study of gene-disease association. (HuGE Navigator)
20881124 CBP plays a crucial role in the formation of both short- and long-term memory; CBP conditional-knockout mice exhibit robust impairment in the formation of spatial, associative, and object-recognition memory.
20805990 Loss of AP-2alpha expression in metastatic melanoma occurs via a dual mechanism involving binding of CREB to the AP-2alpha promoter and CREB-induced overexpression of another oncogenic transcription factor, E2F-1.
20693566 The lipogenic effects of GIP in the presence of insulin are therefore at least partially mediated by upregulation of adipocyte LPL gene transcription through a pathway involving PI3-K/PKB/AMPK-dependent CREB/TORC2 activation.
20685939 These data showed that CREB could promote the transcription and production of IFN-gamma through binding with the IFN-gamma proximal promoter.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20643483 The results preliminary suggest that some genetic polymorphisms in CREB1 could be associated to treatment resistance in major depression.
20643483 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624818 The concerted action of the master transcriptional factors RE1-silencing transcription factor (REST) and cAMP-response element binding protein (CREB) on miR-9-2 promoter induces miRNA expression during differentiation.
20599715 These results indicate that breast cancer cells acquire CREB overexpression during their development and that this CREB upregulation plays an important role in multiple steps of breast cancer bone metastasis.
20573984 Results demonstrate that HIPK2 is a new CREB kinase that regulates CREB-dependent transcription in genotoxic stress.
20541704 GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation.
20536573 An increase in phosphorylation of CREB/ATF-1 in human dental pulp cells was noted after exposure to PGF2alpha for 1-20 min,with a maximal induction at 10 min.
20533262 The rs10932201-rs6740584 haplotype of the CREB1 gene may play an important role in the pathogenesis of MDD.
20533262 Observational study of gene-disease association. (HuGE Navigator)
20498639 repression of CREB1 activity by CCDC6 has a critical function in the development of human thyroid papillary carcinomas carrying RET/PTC1 activation.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20447464 IRE1-alpha-dependent phospho-CREB signaling pathway responsive to NO/Ca(2+) may play an important role in regulating ER-related cell death in glioma
20407870 PKCsigma mediates CREB phosphorylation and GHRP-6-induced growth hormone secretion in GH3 cells.
20407090 DNA sequence variation in the CREB1 locus is strongly associated with DeltaHR50 and explains a considerable proportion of the quantitative trait locus variance.
20402410 The HIV-1 p17 activates the transcription factors c-Myc and CREB in human B cells.
20402410 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198339 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20198332 PKCepsilon regulates Bcl-2 induction through activation of the transcription factor CREB in breast cancer cells.
20160059 ZIP4 overexpression causes increased IL-6 transcription through CREB, which in turn activates STAT3 and leads to increased cyclin D1 expression
20136501 Findings show that oxidative stress and FOXO4 induce PAI-1 expression through modulation of HIF-1alpha and CREB protein levels and that enhanced CREB binding to the PAI-1 promoter is critical for the PAI-1 induction under oxidative stress.
20101207 Tax binds the cyclin D1 promoter-proximal cyclic AMP response element (CRE) in the presence of phosphorylated CREB (pCREB) in vitro, and together the Tax-pCREB complex recruits the cellular co-activator p300 to the promoter.
20100571 The role of CREB and NFkappaB in promoting the synergy was corroborated using IL-6 promoter point mutants, as well as via siRNA-mediated silencing of CREB and NFkappaB.
20097716 ATF/CREB and NGFI-B family members play a crucial role in the transcriptional regulation of CYP11B2 and adrenal cell capacity to produce aldosterone.
20089855 CREB controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro
20037212 observations suggest that aberrant CREB-mediated gene regulation serves as a molecular biomarker of Alzheimer disease-related pathological processes
20033853 phosphorylation is induced by podophyllotoxin
20032081 The anti-angiogenic effect of PPARgamma agonists is due, at least in part, to an interference with the VEGF-stimulated PKCalpha-mediated activation of CREB and the related expression of COX-2.
20018896 The results suggest that CREB-P is dephosphorylated and that HDAC-6 is recruited by the GR, and they play opposite roles in the negative feedback regulation of the GR gene.
19956847 ICAM-3 enhances the migratory and invasive potential of human non-small cell lung cancer cells by inducing MMP-2 and MMP-9 via Akt and CREB
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875824 The presence of viable cells up to 7 days in samples exposed to 6 Gy is explained by Akt activation, which may influence the nuclear transcription factor CREB, leading to resistance to ionizing radiation.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19844206 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19842072 transient over-expression of CREB1 in HepG2 cells activates ACC1 PII promoter and induces the production of triacylglycerol in response to arachidonic acid (AA), indicating that the effect of AA on ACC1 is possibly regulated via CREB1.
19822898 Data show that VEGFR1 promoter binding sites for ELF-1, CREB and EGR-1/3 play a positive role in gene transcription in endothelial cells.
19822084 Results evidence a role for p38 MAPK in activating CREB metabolic pathway in the events leading to erythroid differentiation.
19815709 Data indicate that CREB1 and its target genes are up-regulated in asbestos-exposed human mesothelial cells through an epidermal growth factor receptor/protein kinase A pathway.
19797430 cortisol, via binding to GR, stimulates COX-2 expression by increasing phosphorylated CREB-1 binding to the CRE of the COX-2 gene
19762740 Isoflurane inhibits cyclic adenosine monophosphate response element-binding protein phosphorylation and calmodulin translocation to the nucleus of SH-SY5Y cells.
19718656 MUC5AC is upregulated by IL-4 through CREB in human airway epithelial cells
19632997 CREB promotes melanoma growth and metastasis by down-regulating CCN1/CYR61 expression, which acts as a suppressor of melanoma cell motility, invasion and angiogenesis.
19632326 In transgenic Huntington's disease models, CREB functionality is lost during the early stages of striatal cell stress, and repression of CREB-mediated transcription contributes to the pathogenic process.
19614745 CREB moves from the cytosol to mitochondria, in addition to the nucleus, and, when phosphorylated by cAMP-dependent protein kinase, promotes the expression of mitochondrial genes
19578717 ZCCHC12 enhanced the transcriptional activities of activator protein 1 (AP-1) and cAMP response element binding protein (CREB) as a coactivator
19561568 EWSR1-CREB1 was identified in a clear cell sarcoma of soft tissue providing further evidence that this chimeric variant is not exclusive to gastrointestinal clear cell sarcomas
19553322 These findings indicate that the CREB site in the proximal enhancer of the human cytomegalovirus (HCMV) major immediate early promoterhas a major role for the replication of HCMV.
19548263 Observational study of gene-disease association. (HuGE Navigator)
19531482 cAMP stringently regulates human cathelicidin antimicrobial peptide expression in the mucosal epithelial cells by activating cAMP-response element-binding protein, AP-1, and inducible cAMP early repressor
19517574 results have been supported by a host of additional published findings that implicate sequence variations in CREB1 in the sex-dependent development of syndromic mood disorders, as well as related clinical features and disorders
19473990 MEIS1A transactivation in response to protein kinase A signaling requires the transducers of regulated CREB family of CREB co-activators
19426590 Datashow that CREB might be involved in the very early reprogramming of the host cell during virus activation.
19416972 The first 2250 bp of the HAS2 promoter contain three response elements (REs) for the transcription factor CREB1 as well as two REs for the nuclear receptor RAR
19351775 CREB is overexpressed and constitutively phosphorylated in a number of forms of human cancer, including acute myeloid leukemia and non-small cell lung cancer, and appears to play a direct role in disease pathogenesis and prognosis.
19340314 data identify novel roles for CREB and AhR as major, specific regulators of FSCN-1 transcription in human carcinoma cells but do not support the hypothesis that beta-catenin signaling has a central role
19298866 These data identify the ACTH/cAMP signaling pathway and CREB as transcriptional regulators of the ASAH1 gene in the human adrenal cortex.
19289467 Indirect regulation of presenilins in CREB-mediated transcription.
19251839 IL-17F may be involved in airway inflammation and remodeling via the induction of IL-11, and RafI-MEK1/2-ERK1/2-MSK1-CREB is identified as a novel signaling pathway.
19244110 RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway.
19223597 Exposure of ilset cells to high glucose results in decreased CREB protein expression, phosphorylation, and transcriptional activity associated with apoptosis and impaired beta-cell function.
19211892 Disruption of CREB transgene activity affects murine brain reward processes using intracranial self-stimulation (ICSS) and inducible bitransgenic mice with enriched expression of transgenic CREB in forebrain regions.
19201889 a single pathway from PGF(2alpha) receptor to CREB is responsible for inducing MUC5AC overproduction
19199539 The functional roles of interleukin-17, SLAM and CREB on IFN-gamma production in persons with tuberculosis are reported.
19196967 CREB signaling is potentiated by enhancers of long-term memory
19194961 common variations in the CREB1 gene do not appear to increase susceptibility for Major Depressive Disorder or related phenotypes
19194961 Observational study of gene-disease association. (HuGE Navigator)
19164291 TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19138976 Targeting CREB or NF-kappaB using small-molecule inhibitors, such as KG-501, holds promise as a preventive and/or therapeutic approach for NSCLC.
19136032 These results suggest that the VIP-mediated wound repair of HBECs is associated with activation of CREB via PKA and ERK dependent pathway.
19100722 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
19070599 Expression of recombinant HDAC8 results in decreased CREB activation and CREB mediated gene transcription in response to forskolin application.
18988190 These results support the hypothesis that STAT3 and CREB play an important role in leptin signaling pathway that leads to the proliferation of Ishikawa cells, thus establishing a direct association between obesity and endometrial tumorogenesis.
18930904 hLdhc expression in cancer cells was regulated by transcription factor Sp1 and CREB and promoter CGI methylation
18922788 BDNF- and seizure-dependent phosphorylation of STAT3 cause the adenosine 3',5'-monophosphate (cAMP) response element-binding protein (CREB) family member ICER (inducible cAMP early repressor) to bind with phosphorylated CREB at the Gabra1:CRE site.
18801732 Reduced CREB phosphorylation (Ser-129) associated with inactivation of GSK3beta by Ser-9 phosphorylation may be the major mechanism underlying PEPCK-C gene suppression by AMPK-activating agents such as biguanide
18792986 Sequence analysis of CREB can be a useful diagnostic tool for confirming diagnosis of RTS.
18775326 Data show that RGS13 inhibits CREB-dependent transcription of target genes through disruption of complexes formed at the promoter.
18717645 Stimulation by lithium of the interaction between CREB and its co-activator TORC is reported.
18713830 Results show that VRK1 activates CREB and regulates cell cycle progression in the DNA replication period by inducing cyclin D1 (CCND1) expression.
18678793 The CREB1-linked single-nucleotide polymorphism was associated with significant differential activation in an extended neural network responding to angry and other facial expressions.
18678793 Observational study of gene-disease association. (HuGE Navigator)
18676828 tissue microarray slides containing sections of NSCLC specimens obtained from 310 patients showed a decreased survival duration was associated with overexpression of CREB or p-CREB in never smokers but not in current or former smokers with NSCLC
18660489 Observational study of gene-disease association. (HuGE Navigator)
18626018 TORC2 localization and CREB activity in islet cells
18606955 Observational study of gene-disease association. (HuGE Navigator)
18599546 p-CREB, C/EBPbeta, and CBP are recruited to the CRE of the GnRH-II promoter in a temporarily defined manner to enhance its transcription in JEG-3 and OVCAR-3 cells in response to cAMP
18554190 CREB is frequently overexpressed in ovarian cancer where it appears to promote cell proliferation
18511806 CCR5 expression is regulated by the cAMP/CREB-1 pathway and that interference in this pathway affects endogenous CCR5 transcription.
18485898 CREB decreases the protein level of RCAN1, which is overexpressed in the brain of Down Syndrome patients.
18483184 CREB is a critical regulator of human GRP-R expression in gastrointestinal cancer and might be activated through different upstream intracellular pathways.
18457359 Its phosphorylation regulates activation of MITF and expression of tyrosinase.
18396147 not only CREB but also Sp1 plays a critical role in regulating basal CD2AP promoter activity in renal tubular epithelial cells
18375384 HTLV-1 oncoprotein tax represses ZNF268 expression through the cAMP-responsive element-binding
18287226 although IE86 does repress the UL144-mediated activation of a synthetic NFkB promoter, it is unable to block UL144-mediated activation of the CCL22 promoter, and this lack of responsiveness to IE86 appears to be regulated by binding of CREB.
18189280 results suggest that the CREB1-1H SNP (G/A change), and the CREB1-7H SNP (T/C change) may be associated with bipolar disorder and/or lithium response.
18189280 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18160048 Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.
18070920 These data reveal that phosphorylation of CREB is not sufficient for CBP/p300 recruitment and transcriptional activation.
18034423 CREB is a critical positive regulator of constitutive human MIF gene expression & and thus of MIF-dependent host antimicrobial innate immune defense.
18024382 CREB protein was significantly high (p<0.001) at diagnosis but not during remission
18022816 involvement of CaMKs in the control of glutamate-induced proliferation at a common step downstream of CREB
17975014 CREB is critical for normal myelopoiesis and leukemia cell proliferation
17909078 a novel link between TLR4 and a calcium-dependent signaling cascade comprising CaMKIV-CREB-Bcl-2 that is essential for DC survival.
17889508 A pathway comprising PKCs>Raf-1>MEK-1>ERK-1/-2 mediates the effect of gastrin on the CgA promoter, and strongly suggests that enhanced phosphorylation of Sp1 and CREB is crucial for CgA transactivation through the G protein-coupled CCK-B/gastrin receptor.
17827388 Observational study of gene-disease association. (HuGE Navigator)
17822787 overexpression of either CREB or ATF4 enhanced the activation of the HEC1 promoter and overexpression of both of them had an additive effect on the activation of the HEC1 transcription.
17805329 In CREB-overexpressing transfected cells, Meis1 RNA expression was 3-fold higher than in untransfected cells. In AML cells, it was 5- to 10-fold higher than in the control cells. CREB overexpression may result in leukemia.
17786359 The level of CREB1 in breast cancer patients is elevated and is significantly raised in patients with metastatic disease
17727817 p38/CREB phosphorylation and COX-2 expression are inhibited by olive oil polyphenols
17724745 report for the first time the presence of EWSR1-CREB1 in angiomatoid fibrous histiocytoma, which now appears to be the most frequent gene fusion in this tumor
17712720 Transcription factors of the CREB/CREM/ATF family have a moderate effect on human MC2-R promoter activity, but seem to play a minor role in transmitting stimulation of the cAMP pathway to increased MC2-R expression.
17661722 findings suggest that CREB plays an important role in the pathogenesis of acute leukemia and is a potential biomarker of disease
17646388 Data demonstrate that CREB activation via nonclassical retinoic acid signaling may regulate the expression of mucin genes, including MUC5AC, and mediating the early biological effects of RA during normal mucous differentiation in NHTBE cells.
17592483 Findings suggest that interaction between CREB1 and OPRM1 may be important in nicotine reward.
17573727 the expression of p-CREB is related, in asthma, to the persistent inflammation according to the disease severity. p-CREB expression can be modulated by glucocorticoids in responsive patients.
17565603 CREB has a role in oncogenesis [review]
17565599 the basic leucine zipper domain has a role in the regulation of transcriptional activity of CREB with TORC and salt inducible kinase [review]
17565598 CREB has a role regulating CRE-mediated gene expression during cerebral ischemia [review]
17565597 the CREB transducer of regulated CREB activity 1 coactivator undergoes neuronal activity-dependent translocation from the cytoplasm to the nucleus [review]
17548750 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17507637 The luciferase reporter incoporates CREB and provides optimal perfomance for use in G-protein-coupled receptor drug discovery efforts.
17476304 mediates the differential effects of cAMP and stress pathways on CREB target gene expression in conjunction with TORC2
17460549 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17455223 PRKCD-mediated CREB activation regulates ghrelin-induced COX 2 expression and dinoprostone production in colonic epithelial cells.
17449469 Tax promotes CREB phosphorylation in vivo to ensure availability for Tax transactivation in HTLV-1 infections
17426037 a novel mechanism for activation of the activity of ATM kinase by retinoic acid , and implicate ATM in the regulation of CREB function during RA-induced differentiation.
17389598 PKD1 stimulates GAL4-CREB-mediated transcription in a Ser-133-dependent manner, activates CRE-responsive promoters
17310988 CREB may regulate VEGF transcription via a hypoxia-inducible factor-dependent mechanism in normoxic conditions.
17300755 Observational study of gene-disease association. (HuGE Navigator)
17300755 These preliminary results suggest a strong, gender-specific association between variation at the CREB1 locus and anger expression in major depressive disorder.
17289023 Here we report that the human SOX9 proximal promoter is also regulated by the cyclic-AMP response element binding protein (CREB) and Sp1.
17276404 in contrast to Akt1, Akt2 was unable to induce CREB phosphorylation at Ser-133 in vivo and CREB target gene expression; findings suggest that the regulatory domain of Akts contribute to the functional difference between Akt1 and Akt2
17202341 results suggest that extracellular HIV-Tat induced IL-10 transcription in primary human monocytes is regulated by CREB-1 and Sp-1 transcription factors through the activation of calmodulin/CaMK-II-dependent p38 MAPK
17202341 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
17169345 Heterodimerization of unphosphorylated CREB with either mutant A-CREB or inducible cAMP early repressor triggers CREB protein degradation, whereas phosphorylation prevents CREB from such degradation both in vitro and in vivo.
17082618 Binding of CREB1 to the CD1A promoter in human monocytes suggests a role for ATF/cAMP response element binding protein family members in regulation of CD1A expression
16978443 We observed that the CRE-DNA binding and the protein expression of CREB were significantly decreased in the PFC of teenage suicide victims compared with controls.
16963449 leptin, which is increased in inflamed colonic mucosa, triggers colonic expression of hPepT1 via the CREB and Cdx2 transcription factors
16920714 intracellular HIV-Tat induces IL-10 transcription by ERK MAPK-dependent CREB-1 transcription factor activation through Ser(133) phosphorylation
16920714 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
16896160 gamma-gene induction by butyrate and trichostatin A involves ATF-2 and CREB1 activation via p38 MAPK signaling.
16822311 The presence of CREB, Tax and RNA Polymerase II at the p97Vcp and Sgt1 promoters in vivo through chromatin immunoprecipitation in CTLL/WT cells has been confirmed.
16820098 Akt-and CREB-mediated prostate cancer cell proliferation is inhibited by Nexrutine, a Phellodendron amurense extract
16598418 Findings collectively suggest that CREB phosphorylation may be employed as an in situ marker for hypoxia. Moreover, hypoxia and/or phosphorylation of CREB are associated with the cell invasiveness of pituitary adenomas.
16483570 Considered together, these results underscore a primary role of CREB in preventing apoptosis triggered by Bax, and suggest that Tax might act by affecting the phosphorylation state of CREB.
16449647 expression of PEN-2 is regulated by CREB, and the specific control of PEN-2 expression may imply additional physiological functions uniquely assigned to PEN-2
16339753 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
16306050 metastatic melanoma cells overexpressing CREB/ATF-1 are better equipped than nonmetastatic cells to respond to PAF within the tumor microenvironment.
16227528 CREB/ATF1 and c-Jun were shown to bind to an oligonucleotide encompassing a distal, conserved CREB/AP1 site in the 5'-flanking region of the MUC2 gene, and this cis element was shown to mediate promoter reporter activation by VIP
16207795 Results suggest that hypoxia promotes intestinal epithelial amphiregulin expression in a CREB-dependent manner, an event that may contribute to increased proliferation.
16207717 results demonstrate that regulation of mitochondrial gene expression by mitochondrial CREB, in part, underlies the neuron protective effects of CREB
16158061 Elevated levels of phosphorylated cAMP response element binding protein is associated with lung tumorigenesis
16134057 phosphorylation of CREB is increased by 8-bromo-cAMP, which has opposite effects on TNF and TNFR1 mRNA expression
15999345 Observational study of gene-disease association. (HuGE Navigator)
15999345 Results do not support the previous evidence for CREB1 as a major factor contributing to depression.
15917247 Pellino3 is a novel upstream regulator of p38 MAPK and activates CREB in a p38-dependent manner
15901830 the PI3-kinase/p38(MAPK)/CREB pathway contributes to the EGF activation of NF-IL6beta gene expression
15879136 The contribution of CREB to interferon(IFN)-gamma upregulation is demonstrated in T cells from normal tuberculin reactors, compared to T cells from tuberculosis patients with ineffective immunity, which show reduced CREB activity and low IFN-gamma levels.
15837624 CREB promotes abnormal proliferation and survival of myeloid cells in vitro and in vivo through upregulation of specific target genes and thus is implicated in myeloid cell transformation.
15753290 CREB phosphorylation alone is not a reliable predictor of target gene activation and that additional CREB regulatory partners are required for recruitment of the transcriptional apparatus to the promoter.
15691874 affects the expression of 958 genes in myometrium
15615708 p90 ribosomal S 6 protein kinase 1 (RSK1) mediates the PGE2-induced phosphorylation of cAMP-response element binding protein
15588513 SDF-1/CXCL12 enhanced cell survival in synergy with other cytokines involves activation of CREB and induction of Mcl-1 and c-Fos
15500908 This review article highlights the current findings on the role of nucleus accumbal and amygdaloid CREB signaling in behavioral consequences of alcohol use and abuse.
15340044 Resistance to various antifolates may potentially be associated with impaired activity of Galphas or their coupled receptors, resulting in loss of CREB-1 phosphorylation.
15153340 CREB suppresses the glioblastoma proliferative effect of the stress-induced acetylcholinesterase variant, AChE-R
15082775 identified the in vivo binding sites of CREB1 across the entire human chromosome 22; a large number of potential gene targets for CREB1 have been identified, raising the possibility that it has important roles in a variety of cellular processes
15077295 CRH plays pathogenic role in modulating inflammatory joint disease with CREB/ATF family of transcription factors as principal effector molecules of proinflammatory mediator action in rheumatoid arthritis.
14962944 In VSMCs, LDL-induced mitogenesis involves NOR-1 upregulation through a CREB-dependent mechanism. CREB could play a role in the modulation by LDL of key genes (containing CRE sites) involved in atherogenesis.
14764597 CREB has a role in PPARgamma2 inhibition of cyclin D1 transcription in hepatocytes
14761884 CREB is activated by TNF/TNFR1 signaling through a p38MAPK/MSK1 signaling pathway.
14754893 CREB-1/CREM-1 have roles as regulators of macrophage differentiation
14742439 CREB-1 has a role in the cAMP-induced expression of the survival motor neuron (SMN) gene
14646589 chronic activation CREB and p90RSK in the epileptic hippocampus may be closely associated with the histopathological changes of Ammon's horn sclerosis
14597636 activation of BTK and the subsequent phosphorylation of CREB at Ser-133 are important in the neuronal differentiation of hippocampal progenitor cells.
14597631 CREB-binding protein interacts preferentially with the glycosylated form of Stat5
14580193 role in assembly of CBP-CREB-HTLV-1 tax coactivator-activator complex
14523007 observed CREB phosphorylation via signal pathways and binding of CREB to the cAMP-responsive element after treatment with oxidized phospholipids
12851637 Sequence variations in the CREB1 promoter and intron 8 have been detected that cosegregate with Mood Disorders, or their absence, in women from these families, identifying CREB1 as a sex-limited susceptibility gene for unipolar Mood Disorders.
12829027 The involvement of CREB in STAT5 transactivation was demonstrated by serine-133-mutated CREB, which completely blocked the SCF effect. In addition, the CREB-binding protein CBP/p300 was shown to be essential for EPO- and SCF-mediated STAT5 transactivation
12743114 Tissue transglutaminase directly regulates adenylyl cyclase resulting in enhanced cAMP-response element-binding protein (CREB) activation.
12720543 Levels of CREB mRNA in thyroid carcinomas, but not in adenomas, were significantly lower than in corresponding normal tissue.
12690113 IL1beta and TNFalpha activation of MSK1 and CREB and cAMP-response element signaling cascades occurs via ERK/p38 MAP kinases and are crucial aspects of the intracellular mechanisms that mediate MUC5AC gene expression
12676584 CREB1 associates with TIF2 and is essential for cell transformation.
12567184 Here we show that HDAC1 associates with and blocks Ser133 phosphorylation of CREB during pre-stimulus and attenuation phases of the cAMP response
12552083 CREB response to hypoxia is modified by small ubiquitin-related modifier-1 (SUMO-1)
12437352 Structurally distinct modes of recognition of the KIX domain of CBP by Jun and CREB
12391222 CREB1 plays an important role in the trans-activation of the MHC class II trans-activator (CIITA) promoter III in B cells.
12391146 Oct-1 potentiates CREB-dependent cyclin D1 transcriptional activity by a phospho-CREB and CREB binding protein-independent mechanism
12368293 CREB activity is an important step for nitric oxide-mediated survival in neuronal cells
12220644 hGRP-R activation stimulated sustained cyclic AMP response element binding protein (CREB) phosphorylation and transactivation in duodenal cancer cells through a protein kinase C and partially p38 mitogen-activated protein kinase-dependent pathway.
12200150 CREB-DNA binding by magnetic fields is dependent on calcium ions.
12183445 is co-expressed with CREB and CBP in extravillous cytotrophoblasts, revealing the in vivo relevance of this transactivation pathway
12145339 CREB and sterol regulatory element binding protein cooperate in transactivating CYP51.
12091337 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
11988318 review of CREB transcription factor involvment with spermatogenesis
11156964 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control
9558095 The RNA and protein levels of cAMP responsive element binding protein (CREB) decreases in Vpr-treated human neurons compared to the untreated control

AA Sequence

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVI      1 - 70
QAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILND     71 - 140
LSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMT    141 - 210
NAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAE    211 - 280
EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD             281 - 341
//

Text Mined References (477)

PMID Year Title
27049759 2016 GSK-3? Is a Novel Target of CREB and CREB-GSK-3? Signaling Participates in Cell Viability in Lung Cancer.
26996991 2016 The microRNA miR-124 suppresses seizure activity and regulates CREB1 activity.
26823765 2015 C/EBP? inhibits proliferation of breast cancer cells via a novel pathway of miR-134/CREB.
26757817 2016 Transcription Factors and DNA Repair Enzymes Compete for Damaged Promoter Sites.
26755589 2016 Nuclear TRAF3 is a negative regulator of CREB in B cells.
26669856 2015 Nontypeable Haemophilus influenzae-Induced MyD88 Short Expression Is Regulated by Positive IKK? and CREB Pathways and Negative ERK1/2 Pathway.
26655813 2016 Inhibition of cyclic AMP response element-directed transcription by decoy oligonucleotides enhances tumor-specific radiosensitivity.
26649298 2015 PFOS Disturbs BDNF-ERK-CREB Signalling in Association with Increased MicroRNA-22 in SH-SY5Y Cells.
26642955 2016 CREB is activated by ER stress and modulates the unfolded protein response by regulating the expression of IRE1? and PERK.
26626456 2016 Clinical and genetic factors associated with suicide in mood disorder patients.
26617801 2015 MicroRNA-506 inhibits esophageal cancer cell proliferation via targeting CREB1.
26610485 2015 CREB Negatively Regulates IGF2R Gene Expression and Downstream Pathways to Inhibit Hypoxia-Induced H9c2 Cardiomyoblast Cell Death.
26573110 2016 Involvement of cyclic-nucleotide response element-binding family members in the radiation response of Ramos B lymphoma cells.
26546821 2015 Krüppel-like factor 4 synergizes with CREB to increase the activity of apolipoprotein E gene promoter in macrophages.
26474850 2015 The autophagy GABARAPL1 gene is epigenetically regulated in breast cancer models.
26472185 2015 CREB1-driven expression of miR-320a promotes mitophagy by down-regulating VDAC1 expression during serum starvation in cervical cancer cells.
26398148 2015 Transcription factor cyclic adenosine monophosphate responsive element binding protein negatively regulates tumor necrosis factor alpha-induced protein 1 expression.
26352206 2015 Nicotinamide ameliorates palmitate-induced ER stress in hepatocytes via cAMP/PKA/CREB pathway-dependent Sirt1 upregulation.
26348925 2015 Estrogen receptor ? L429 and A430 regulate 17?-estradiol-induced cell proliferation via CREB1.
26294214 2015 Akt Kinase-Interacting Protein 1 Signals through CREB to Drive Diffuse Malignant Mesothelioma.
26279447 2015 Lactoferrin Inhibits IL-1?-Induced Chondrocyte Apoptosis Through AKT1-Induced CREB1 Activation.
26263387 2015 Novel Epigenetic CREB-miR-630 Signaling Axis Regulates Radiosensitivity in Colorectal Cancer.
26245996 2015 Expression of ROR1, pAkt, and pCREB in gastric adenocarcinoma.
26185160 2015 GABP? Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1: Custom DNA Microarrays.
26124005 2015 Resveratrol induces AMPK-dependent MDR1 inhibition in colorectal cancer HCT116/L-OHP cells by preventing activation of NF-?B signaling and suppressing cAMP-responsive element transcriptional activity.
26109721 2015 Screening of the Human Kinome Identifies MSK1/2-CREB1 as an Essential Pathway Mediating Kaposi's Sarcoma-Associated Herpesvirus Lytic Replication during Primary Infection.
26036429 2015 Decrease of phosphorylated proto-oncogene CREB at Ser 133 site inhibits growth and metastatic activity of renal cell cancer.
26025137 2015 CREB expression mediates amyloid ?-induced basal BDNF downregulation.
26008971 2015 Essential role for cyclic-AMP responsive element binding protein 1 (CREB) in the survival of acute lymphoblastic leukemia.
25951193 2015 The integral membrane protein ITM2A, a transcriptional target of PKA-CREB, regulates autophagic flux via interaction with the vacuolar ATPase.
25940704 2015 The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma.
25939814 2015 CREB-BDNF pathway influences alcohol cue-elicited activation in drinkers.
25936964 2015 The hepatitis B virus (HBV) core protein enhances the transcription activation of CRE via the CRE/CREB/CBP pathway.
25936754 2015 An essential role of cAMP response element-binding protein in epidermal growth factor-mediated induction of sodium/glucose cotransporter 1 gene expression and intestinal glucose uptake.
25934695 2015 Colorectal Carcinogenesis: Connecting K-RAS-Induced Transformation and CREB Activity In Vitro and In Vivo.
25883219 2015 PKC?-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25847246 2015 Association of MMP7 -181A?G Promoter Polymorphism with Gastric Cancer Risk: INFLUENCE OF NICOTINE IN DIFFERENTIAL ALLELE-SPECIFIC TRANSCRIPTION VIA INCREASED PHOSPHORYLATION OF cAMP-RESPONSE ELEMENT-BINDING PROTEIN (CREB).
25843777 2015 CREB is a key negative regulator of carbonic anhydrase IX (CA9) in gastric cancer.
25825983 2015 High expression of cAMP-responsive element-binding protein 1 (CREB1) is associated with metastasis, tumor stage and poor outcome in gastric cancer.
25814225 2015 Increased PTPN22 expression and defective CREB activation impair regulatory T-cell differentiation in non-ST-segment elevation acute coronary syndromes.
25809782 2015 Myocyte enhancer factor (MEF)-2 plays essential roles in T-cell transformation associated with HTLV-1 infection by stabilizing complex between Tax and CREB.
25808826 2015 Increased SPHK2 Transcription of Human Colon Cancer Cells in Serum-Depleted Culture: The Involvement of CREB Transcription Factor.
25755794 2015 CREB1 gene polymorphisms combined with environmental risk factors increase susceptibility to major depressive disorder (MDD).
25707758 2015 Lysine acetyltransferases cyclic adenosine monophosphate response element-binding binding protein and acetyltransferase p300 attenuate transcriptional activity of the mineralocorticoid receptor through its acetylation.
25648114 2015 MiR-1224-5p acts as a tumor suppressor by targeting CREB1 in malignant gliomas.
25625293 2015 Cyclic adenosine monophosphate response element-binding protein transcriptionally regulates CHCHD2 associated with the molecular pathogenesis of hepatocellular carcinoma.
25615818 2015 Functional cyclic AMP response element in the breast cancer resistance protein (BCRP/ABCG2) promoter modulates epidermal growth factor receptor pathway- or androgen withdrawal-mediated BCRP/ABCG2 transcription in human cancer cells.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25607216 2015 PKA/CREB regulates the constitutive promoter activity of the USP22 gene.
25605016 2015 Upregulation of miR-328 and inhibition of CREB-DNA-binding activity are critical for resveratrol-mediated suppression of matrix metalloproteinase-2 and subsequent metastatic ability in human osteosarcomas.
25563814 2015 p-CREB expression in human meningiomas: correlation with angiogenesis and recurrence risk.
25541153 2015 Replication factor C3 is a CREB target gene that regulates cell cycle progression through the modulation of chromatin loading of PCNA.
25528004 2015 The minimal promoter region of the dense-core vesicle protein IA-2: transcriptional regulation by CREB.
25476123 2015 p-CREB expression in human gliomas: potential use in the differential diagnosis between astrocytoma and oligodendroglioma.
25382680 2015 Transcription factor CREB is involved in CaSR-mediated cytoskeleton gene expression.
25348080 2014 Kinetic modulation of a disordered protein domain by phosphorylation.
25319707 2014 Manipulating a "cocaine engram" in mice.
25277212 2014 Calcium-dependent FAK/CREB/TNNC1 signalling mediates the effect of stromal MFAP5 on ovarian cancer metastatic potential.
25277185 2014 High mobility group Box-1 inhibits cancer cell motility and metastasis by suppressing activation of transcription factor CREB and nWASP expression.
25175744 2014 The cAMP-responsive element binding protein (CREB) transcription factor regulates furin expression during human trophoblast syncytialization.
25150575 2014 Genetic variants in a 'cAMP element binding protein' (CREB)-dependent histone acetylation pathway influence memory performance in cognitively healthy elderly individuals.
25111229 2014 CREB-induced inflammation is important for malignant mesothelioma growth.
25109834 2014 Prostaglandin E2 promotes the cell growth and invasive ability of hepatocellular carcinoma cells by upregulating c-Myc expression via EP4 receptor and the PKA signaling pathway.
25099937 2014 Ethanol suppresses PGC-1? expression by interfering with the cAMP-CREB pathway in neuronal cells.
25084773 2014 Active CREB1 promotes a malignant TGF?2 autocrine loop in glioblastoma.
25071166 2014 CRTC1/MAML2 gain-of-function interactions with MYC create a gene signature predictive of cancers with CREB-MYC involvement.
25043418 2014 Molecular evolution in the CREB1 signal pathway and a rare haplotype in CREB1 with genetic predisposition to schizophrenia.
25033730 2014 Prognostic value of coexistence of abnormal expression of micro-RNA-200b and cyclic adenosine monophosphate-responsive element-binding protein 1 in human astrocytoma.
24966904 2014 DCC is expressed in a CD166-positive subpopulation of chondrocytes in human osteoarthritic cartilage and modulates CRE activity.
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24955721 2015 Association study of CREB1 polymorphisms and suicidality in MDD: results from a European multicenter study on treatment resistant depression.
24836190 2014 Aromatase induction in tamoxifen-resistant breast cancer: Role of phosphoinositide 3-kinase-dependent CREB activation.
24833716 2014 Haplotype-specific modulation of a SOX10/CREB response element at the Charcot-Marie-Tooth disease type 4C locus SH3TC2.
24819468 2014 Ras oncoprotein disrupts the TSH/CREB signaling upstream adenylyl cyclase in human thyroid cell.
24796664 2014 Increased expression of sorcin is associated with multidrug resistance in leukemia cells via up-regulation of MDR1 expression through cAMP response element-binding protein.
24792438 2014 Lysophosphatidic acid-induced IL-8 secretion involves MSK1 and MSK2 mediated activation of CREB1 in human fibroblast-like synoviocytes.
24781730 2014 Aging impairs transcriptional regulation of vascular endothelial growth factor in human microvascular endothelial cells: implications for angiogenesis and cell survival.
24774361 2014 CREB is activated in smooth muscle cells isolated from atherosclerotic plaques and reduces smooth muscle cell proliferation via p21-dependent mechanism.
24743054 2014 Akt and PI3K-dependent but CREB-independent upregulation of MCAM by endothelin-3 in human melanocytes.
24704376 2014 Association of CREB1 gene polymorphism with drug seeking behaviour in eastern Indian addicts.
24655565 2014 Exemestane blocks mesothelioma growth through downregulation of cAMP, pCREB and CD44 implicating new treatment option in patients affected by this disease.
24651445 2014 L-arginine stimulates fibroblast proliferation through the GPRC6A-ERK1/2 and PI3K/Akt pathway.
24627100 2014 Extracellular visfatin activates gluconeogenesis in HepG2 cells through the classical PKA/CREB-dependent pathway.
24598141 2014 Transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH.
24488767 2014 Fat mass and obesity-associated (FTO) protein interacts with CaMKII and modulates the activity of CREB signaling pathway.
24366569 2014 PF-3758309, p21-activated kinase 4 inhibitor, suppresses migration and invasion of A549 human lung cancer cells via regulation of CREB, NF-?B, and ?-catenin signalings.
24338025 2014 NF-?B and enhancer-binding CREB protein scaffolded by CREB-binding protein (CBP)/p300 proteins regulate CD59 protein expression to protect cells from complement attack.
24334212 2014 GSK3?, CREB, and BDNF in peripheral blood of patients with Alzheimer's disease and depression.
24316029 2014 Inhibition of human cytomegalovirus replication by overexpression of CREB1.
24289115 2013 LncRNA DQ786243 affects Treg related CREB and Foxp3 expression in Crohn's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257117 2014 Cyclic AMP response element binding (CREB) protein acts as a positive regulator of SOX3 gene expression in NT2/D1 cells.
24244341 2013 NF-?B and CREB are required for angiotensin II type 1 receptor upregulation in neurons.
24233491 2014 Cyclic adenosine monophosphate-response element-binding protein mediates the proangiogenic or proinflammatory activity of gremlin.
24085294 2013 The prometastatic ribosomal S6 kinase 2-cAMP response element-binding protein (RSK2-CREB) signaling pathway up-regulates the actin-binding protein fascin-1 to promote tumor metastasis.
24065533 2013 The HTLV-1 HBZ protein inhibits cyclin D1 expression through interacting with the cellular transcription factor CREB.
24055910 2014 The gep proto-oncogene G?12 mediates LPA-stimulated activation of CREB in ovarian cancer cells.
24041570 2014 Coordinated transcriptional regulation of Hspa1a gene by multiple transcription factors: crucial roles for HSF-1, NF-Y, NF-?B, and CREB.
24025972 2013 HER-2/neu mediates oncogenic transformation via altered CREB expression and function.
23979134 2013 MicroRNA-433 inhibits liver cancer cell migration by repressing the protein expression and function of cAMP response element-binding protein.
23896026 2013 Inhibition of protein translation as a mechanism of acidotic pH protection against ischaemic injury through inhibition of CREB mediated tRNA synthetase expression.
23894352 2013 Hepatic cannabinoid receptor type 1 mediates alcohol-induced regulation of bile acid enzyme genes expression via CREBH.
23857777 2013 A novel epigenetic CREB-miR-373 axis mediates ZIP4-induced pancreatic cancer growth.
23844928 2014 Preliminary investigation of the influence of CREB1 gene polymorphisms on cognitive dysfunction in Chinese patients with major depression.
23838680 2013 Expression of CREB in primary pterygium and correlation with cyclin D1, ki-67, MMP7, p53, p63, Survivin and Vimentin.
23814058 2013 Cyclin-dependent kinase 1-dependent phosphorylation of cAMP response element-binding protein decreases chromatin occupancy.
23727510 2013 Human endogenous retrovirus W family envelope gene activates the small conductance Ca2+-activated K+ channel in human neuroblastoma cells through CREB.
23708553 2013 Calcitonin gene-related peptide stimulates BMP-2 expression and the differentiation of human osteoblast-like cells in vitro.
23619509 2013 BDNF and CREB1 genetic variants interact to affect antidepressant treatment outcomes in geriatric depression.
23568192 2014 Allelic differences between Europeans and Chinese for CREB1 SNPs and their implications in gene expression regulation, hippocampal structure and function, and bipolar disorder susceptibility.
23543137 2013 MicroRNA-200b targets CREB1 and suppresses cell growth in human malignant glioma.
23537502 2013 Evaluation of the role of MAPK1 and CREB1 polymorphisms on treatment resistance, response and remission in mood disorder patients.
23532963 2013 Mutual interaction between YAP and CREB promotes tumorigenesis in liver cancer.
23526216 2013 Role of hypoxia-inducible factor 1, ? subunit and cAMP-response element binding protein 1 in synergistic release of interleukin 8 by prostaglandin E2 and nickel in lung fibroblasts.
23504989 2013 CREB is necessary for synaptic maintenance and learning-induced changes of the AMPA receptor GluA1 subunit.
23494562 2013 Prostaglandin E2 receptor EP1 phosphorylate CREB and mediates MMP2 expression in human cholangiocarcinoma cells.
23469012 2013 cAMP responsive element binding protein-1 is a transcription factor of lysosomal-associated protein transmembrane-4 Beta in human breast cancer cells.
23462962 2013 cAMP response element-binding protein interacts with and stimulates the proteasomal degradation of the nuclear receptor coactivator GRIP1.
23417028 2013 Deficiency of CREB and over expression of miR-183 in juvenile myelomonocytic leukemia.
23403511 2013 Rapamycin increases pCREB, Bcl-2, and VEGF-A through ERK under normoxia.
23382855 2013 Enrichment of conserved synaptic activity-responsive element in neuronal genes predicts a coordinated response of MEF2, CREB and SRF.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23297769 2013 Glycogen synthase kinase-3 (GSK-3) regulates TGF-??-induced differentiation of pulmonary fibroblasts.
23220172 2013 Overexpression of human selenoprotein H in neuronal cells enhances mitochondrial biogenesis and function through activation of protein kinase A, protein kinase B, and cyclic adenosine monophosphate response element-binding protein pathway.
23213254 2012 Mechanism of CREB recognition and coactivation by the CREB-regulated transcriptional coactivator CRTC2.
23195957 2013 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185366 2012 The CREB-miR-9 negative feedback minicircuitry coordinates the migration and proliferation of glioma cells.
23168992 2012 Integrated copy number and gene expression analysis detects a CREB1 association with Alzheimer's disease.
23143030 2013 Transcription factor CREB is phosphorylated in human molar odontoblasts and cementoblasts in vivo.
23127979 2013 Cyclic adenosine monophosphate response-element binding protein activation by mitogen-activated protein kinase-activated protein kinase 3 and four-and-a-half LIM domains 5 plays a key role for vein graft intimal hyperplasia.
23100280 2013 MicroRNA-34b promoter hypermethylation induces CREB overexpression and contributes to myeloid transformation.
23086924 2012 Neuron-restrictive silencer factor (NRSF) represses cocaine- and amphetamine-regulated transcript (CART) transcription and antagonizes cAMP-response element-binding protein signaling through a dual NRSE mechanism.
23055509 2012 Layer-specific CREB target gene induction in human neocortical epilepsy.
23049845 2012 The CaMK4/CREB/IRS-2 cascade stimulates proliferation and inhibits apoptosis of ?-cells.
23038261 2012 Rit-mediated stress resistance involves a p38-mitogen- and stress-activated protein kinase 1 (MSK1)-dependent cAMP response element-binding protein (CREB) activation cascade.
23032945 2012 Genetic association of cyclic AMP signaling genes with bipolar disorder.
23020846 2012 Neuroprotective actions of glucagon-like peptide-1 in differentiated human neuroprogenitor cells.
23019365 2012 cAMP response element-binding protein promotes gliomagenesis by modulating the expression of oncogenic microRNA-23a.
23011268 2013 Disrupted-in-schizophrenia-1 Gln31Leu polymorphism results in social anhedonia associated with monoaminergic imbalance and reduction of CREB and ?-arrestin-1,2 in the nucleus accumbens in a mouse model of depression.
22922957 2012 Extracellular acidification activates cAMP responsive element binding protein via Na+/H+ exchanger isoform 1-mediated Ca²? oscillation in central nervous system pericytes.
22743041 2012 Sphingosine 1-phosphate induces MKP-1 expression via p38 MAPK- and CREB-mediated pathways in airway smooth muscle cells.
22726539 2012 Critical roles of the cAMP-responsive element-binding protein-mediated pathway in disorganized epithelial phenotypes caused by mitochondrial dysfunction.
22669896 2012 Phytoestrogen genistein up-regulates endothelial nitric oxide synthase expression via activation of cAMP response element-binding protein in human aortic endothelial cells.
22627767 2012 Sox4 cooperates with CREB in myeloid transformation.
22609331 2012 Norepinephrine differentially modulates the innate inflammatory response provoked by amyloid-? peptide via action at ?-adrenoceptors and activation of cAMP/PKA pathway in human THP-1 macrophages.
22574704 2012 CREB1 modulates the influence of childhood sexual abuse on adult's anger traits.
22570239 2012 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling: implications in ADPKD cell proliferation.
22561749 2012 Acidosis-induced V-ATPase trafficking in salivary ducts is initiated by cAMP/PKA/CREB pathway via regulation of Rab11b expression.
22539488 2012 MicroRNA-181b targets cAMP responsive element binding protein 1 in gastric adenocarcinomas.
22510762 2012 Tumors with EWSR1-CREB1 and EWSR1-ATF1 fusions: the current status.
22505473 2012 cAMP response element-binding (CREB) recruitment following a specific CpG demethylation leads to the elevated expression of the matrix metalloproteinase 13 in human articular chondrocytes and osteoarthritis.
22469229 2012 cAMP response element-binding protein 1 is required for hydroxyurea-mediated induction of ?-globin expression in K562 cells.
22386572 2012 Case-control association study of 14 variants of CREB1, CREBBP and CREM on diagnosis and treatment outcome in major depressive disorder and bipolar disorder.
22383952 2012 Transcriptional regulation of N-acetylglutamate synthase.
22349818 2013 Coordinate regulation of estrogen receptor ? degradation by Mdm2 and CREB-binding protein in response to growth signals.
22325466 2012 MicroRNA-182 targets cAMP-responsive element-binding protein 1 and suppresses cell growth in human gastric adenocarcinoma.
22294156 2012 Human tau may modify glucocorticoids-mediated regulation of cAMP-dependent kinase and phosphorylated cAMP response element binding protein.
22293360 2012 Genotype distributions and allele frequencies of possible major depressive disorder-associated single nucleotide polymorphisms, cyclic adenosine monophosphate response element binding protein 1 rs4675690 and Piccolo rs2522833, in a Japanese population.
22285928 2012 Long non-coding RNA UCA1 regulated cell cycle distribution via CREB through PI3-K dependent pathway in bladder carcinoma cells.
22271686 2012 CD44 proteolysis increases CREB phosphorylation and sustains proliferation of thyroid cancer cells.
22267179 2012 A p.D116G mutation in CREB1 leads to novel multiple malformation syndrome resembling CrebA knockout mouse.
22253425 2012 Antiapoptotic actions of exendin-4 against hypoxia and cytokines are augmented by CREB.
22219277 2012 HIV-1 Tat triggers nuclear localization of ZO-1 via Rho signaling and cAMP response element-binding protein activation.
22198373 2012 Possible influence of CREB1, CREBBP and CREM variants on diagnosis and treatment outcome in patients with schizophrenia.
22185778 2012 Daxx interacts with and modulates the activity of CREB.
22180334 2012 No evidence of non-homologous insertions in mouse model of MDD created by replacement of homologous mouse DNA sequence with pathogenic 6-base human CREB1 promoter sequence.
22127929 2012 A selective human bombesin receptor subtype-3 peptide agonist mediates CREB phosphorylation and transactivation.
22072831 2011 NF-?B and CREB are involved in IL-8 production of human neutrophils induced by Trichomonas vaginalis-derived secretory products.
22027994 2012 CREB-activity and nmnat2 transcription are down-regulated prior to neurodegeneration, while NMNAT2 over-expression is neuroprotective, in a mouse model of human tauopathy.
21998402 2011 Impaired expression of the inducible cAMP early repressor accounts for sustained adipose CREB activity in obesity.
21997693 2011 Primary pulmonary myxoid sarcoma with EWSR1-CREB1 fusion: a new tumor entity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21832046 2011 The extracellular signal-regulated kinase mitogen-activated protein kinase/ribosomal S6 protein kinase 1 cascade phosphorylates cAMP response element-binding protein to induce MUC5B gene expression via D-prostanoid receptor signaling.
21784978 2011 Constitutive cAMP response element binding protein (CREB) activation by Alzheimer's disease presenilin-driven inositol trisphosphate receptor (InsP3R) Ca2+ signaling.
21734652 2011 Increasing CREB function in the CA1 region of dorsal hippocampus rescues the spatial memory deficits in a mouse model of Alzheimer's disease.
21706049 2012 Altered LKB1/CREB-regulated transcription co-activator (CRTC) signaling axis promotes esophageal cancer cell migration and invasion.
21705328 2011 Dual function of protein kinase C (PKC) in 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced manganese superoxide dismutase (MnSOD) expression: activation of CREB and FOXO3a by PKC-alpha phosphorylation and by PKC-mediated inactivation of Akt, respectively.
21644508 2011 ?-arrestin-2 regulation of the cAMP response element binding protein.
21598377 2011 Replacement of homologous mouse DNA sequence with pathogenic 6-base human CREB1 promoter sequence creates murine model of major depressive disorder.
21497119 2011 Regulation of ?-globin gene expression involves signaling through the p38 MAPK/CREB1 pathway.
21483768 2011 DC priming by M. vaccae inhibits Th2 responses in contrast to specific TLR2 priming and is associated with selective activation of the CREB pathway.
21418524 2011 Substrate preference and phosphatidylinositol monophosphate inhibition of the catalytic domain of the Per-Arnt-Sim domain kinase PASKIN.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398611 2011 Mal mediates TLR-induced activation of CREB and expression of IL-10.
21325281 2011 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21295542 2011 CREB represses p53-dependent transactivation of MDM2 through the complex formation with p53 and contributes to p53-mediated apoptosis in response to glucose deprivation.
21268077 2011 Enterovirus 71 modulates a COX-2/PGE2/cAMP-dependent viral replication in human neuroblastoma cells: role of the c-Src/EGFR/p42/p44 MAPK/CREB signaling pathway.
21215389 2011 The CREB1-BDNF-NTRK2 pathway in depression: multiple gene-cognition-environment interactions.
21172805 2011 TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
21084670 2010 The role of the transcription factor CREB in immune function.
21079758 2010 Nonnative interactions in coupled folding and binding processes of intrinsically disordered proteins.
21075212 2011 A CRE that binds CREB and contributes to PKA-dependent regulation of the proximal promoter of human RAB25 gene.
21044077 2011 CREB: a multifaceted regulator of neuronal plasticity and protection.
21034562 2010 Intracellular CMTM2 negatively regulates human immunodeficiency virus type-1 transcription through targeting the transcription factors AP-1 and CREB.
20979795 2010 [The relationship between cyclic adenosine monophosphate response element-binding protein and interferon-? gene promoter in tuberculosis patients].
20945072 2010 Neurogenic transdifferentiation of human adipose-derived stem cells? A critical protocol reevaluation with special emphasis on cell proliferation and cell cycle alterations.
20943350 2011 Epistatic interaction of CREB1 and KCNJ6 on rumination and negative emotionality.
20936779 2010 A human MAP kinase interactome.
20881124 2010 CREB binding protein is required for both short-term and long-term memory formation.
20805990 2010 CREB inhibits AP-2alpha expression to regulate the malignant phenotype of melanoma.
20693566 2010 GIP increases human adipocyte LPL expression through CREB and TORC2-mediated trans-activation of the LPL gene.
20685939 2010 CREB is a positive transcriptional regulator of gamma interferon in latent but not active tuberculosis infections.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20643483 2011 A preliminary investigation of the influence of CREB1 gene on treatment resistance in major depression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624818 2010 A minicircuitry involving REST and CREB controls miR-9-2 expression during human neuronal differentiation.
20599715 2010 cAMP-response-element-binding protein positively regulates breast cancer metastasis and subsequent bone destruction.
20573984 2010 Regulation of genotoxic stress response by homeodomain-interacting protein kinase 2 through phosphorylation of cyclic AMP response element-binding protein at serine 271.
20541704 2010 GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis.
20536573 2010 Prostaglandin F(2alpha) stimulates MEK-ERK signalling but decreases the expression of alkaline phosphatase in dental pulp cells.
20533262 2010 [Association of cyclic adenosine monophosphate response element-binding protein gene and major depressive disorder].
20498639 2010 CCDC6 represses CREB1 activity by recruiting histone deacetylase 1 and protein phosphatase 1.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20447464 2010 Nitric oxide induction of IRE1-alpha-dependent CREB phosphorylation in human glioma cells.
20407870 2010 GHRP-6 induces CREB phosphorylation and growth hormone secretion via a protein kinase Csigma-dependent pathway in GH3 cells.
20407090 2010 CREB1 is a strong genetic predictor of the variation in exercise heart rate response to regular exercise: the HERITAGE Family Study.
20402410 2010 The HIV-1 matrix protein p17 activates the transcription factors c-Myc and CREB in human B cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20198339 2010 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20198332 2010 PKCepsilon induces Bcl-2 by activating CREB.
20160059 2010 ZIP4 regulates pancreatic cancer cell growth by activating IL-6/STAT3 pathway through zinc finger transcription factor CREB.
20159610 2010 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia.
20136501 2010 FOXO4 induces human plasminogen activator inhibitor-1 gene expression via an indirect mechanism by modulating HIF-1alpha and CREB levels.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20101207 2010 The HTLV-1 tax protein cooperates with phosphorylated CREB, TORC2 and p300 to activate CRE-dependent cyclin D1 transcription.
20100571 2010 Cooperation of NFkappaB and CREB to induce synergistic IL-6 expression in astrocytes.
20097716 2010 Regulation of aldosterone synthase by activator transcription factor/cAMP response element-binding protein family members.
20089855 2010 cAMP-response element-binding protein (CREB) controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro.
20037212 2009 Molecular network analysis suggests aberrant CREB-mediated gene regulation in the Alzheimer disease hippocampus.
20033853 2010 Podophyllotoxin induces CREB phosphorylation and CRE-driven gene expression via PKA but not MAPKs.
20032081 2010 PPARgamma agonists inhibit angiogenesis by suppressing PKCalpha- and CREB-mediated COX-2 expression in the human endothelium.
20018896 2010 Recruitment of cAMP-response element-binding protein and histone deacetylase has opposite effects on glucocorticoid receptor gene transcription.
19956847 2010 ICAM-3 enhances the migratory and invasive potential of human non-small cell lung cancer cells by inducing MMP-2 and MMP-9 via Akt and CREB.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875824 2009 Ionizing radiation induces apoptotic signal through protein kinase Cdelta (delta) and survival signal through Akt and cyclic-nucleotide response element-binding protein (CREB) in Jurkat T cells.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19861239 2010 cJun modulates Ggamma-globin gene expression via an upstream cAMP response element.
19844206 2009 Sequence variations of ABCB1, SLC6A2, SLC6A3, SLC6A4, CREB1, CRHR1 and NTRK2: association with major depression and antidepressant response in Mexican-Americans.
19842072 2009 Arachidonic acid induces acetyl-CoA carboxylase 1 expression via activation of CREB1.
19822898 2009 Differential roles for ETS, CREB, and EGR binding sites in mediating VEGF receptor 1 expression in vivo.
19822084 Regulation of CREB activation by p38 mitogen activated protein kinase during human primary erythroblast differentiation.
19815709 2009 Activated cAMP response element binding protein is overexpressed in human mesotheliomas and inhibits apoptosis.
19797430 2009 Paradoxical stimulation of cyclooxygenase-2 expression by glucocorticoids via a cyclic AMP response element in human amnion fibroblasts.
19762740 2009 Isoflurane inhibits cyclic adenosine monophosphate response element-binding protein phosphorylation and calmodulin translocation to the nucleus of SH-SY5Y cells.
19718656 2009 Upregulation of MUC5AC gene expression by IL-4 through CREB in human airway epithelial cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19632997 2009 Silencing cAMP-response element-binding protein (CREB) identifies CYR61 as a tumor suppressor gene in melanoma.
19632326 2009 CREB is a key regulator of striatal vulnerability in chemical and genetic models of Huntington's disease.
19614745 2009 cAMP response element-binding protein (CREB) is imported into mitochondria and promotes protein synthesis.
19578717 2009 Human ZCCHC12 activates AP-1 and CREB signaling as a transcriptional co-activator.
19561568 2009 Detection and characterization of EWSR1/ATF1 and EWSR1/CREB1 chimeric transcripts in clear cell sarcoma (melanoma of soft parts).
19553322 2009 The CREB site in the proximal enhancer is critical for cooperative interaction with the other transcription factor binding sites to enhance transcription of the major intermediate-early genes in human cytomegalovirus-infected cells.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19531482 2009 cAMP stringently regulates human cathelicidin antimicrobial peptide expression in the mucosal epithelial cells by activating cAMP-response element-binding protein, AP-1, and inducible cAMP early repressor.
19517574 2010 Genetic linkage of region containing the CREB1 gene to depressive disorders in families with recurrent, early-onset, major depression: a re-analysis and confirmation of sex-specific effect.
19473990 2009 Transcriptional activation by MEIS1A in response to protein kinase A signaling requires the transducers of regulated CREB family of CREB co-activators.
19426590 2009 [Human cytomegalovirus-encoded US28 stimulates the CREB related transcriptional activity].
19416972 2009 Regulation of the hyaluronan synthase 2 gene by convergence in cyclic AMP response element-binding protein and retinoid acid receptor signaling.
19351775 2009 CREB in the pathophysiology of cancer: implications for targeting transcription factors for cancer therapy.
19340314 2009 Fascin-1 promoter activity is regulated by CREB and the aryl hydrocarbon receptor in human carcinoma cells.
19298866 2009 The cAMP-responsive element binding protein (CREB) regulates the expression of acid ceramidase (ASAH1) in H295R human adrenocortical cells.
19289467 2009 Indirect regulation of presenilins in CREB-mediated transcription.
19251839 2009 IL-17F-induced IL-11 release in bronchial epithelial cells via MSK1-CREB pathway.
19244110 2009 RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway.
19223597 2009 Degradation of cAMP-responsive element-binding protein by the ubiquitin-proteasome pathway contributes to glucotoxicity in beta-cells and human pancreatic islets.
19211892 2009 Altered sensitivity to rewarding and aversive drugs in mice with inducible disruption of cAMP response element-binding protein function within the nucleus accumbens.
19201889 2009 CREB mediates prostaglandin F2alpha-induced MUC5AC overexpression.
19199539 2009 IFN-gamma production during active tuberculosis is regulated by mechanisms that involve IL-17, SLAM, and CREB.
19196967 2009 Identification of compounds that potentiate CREB signaling as possible enhancers of long-term memory.
19194961 2009 Association study of CREB1 with Major Depressive Disorder and related phenotypes.
19164291 2009 TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19138976 2008 Cyclic AMP-responsive element binding protein- and nuclear factor-kappaB-regulated CXC chemokine gene expression in lung carcinogenesis.
19136032 2009 Role of CREB in vasoactive intestinal peptide-mediated wound healing in human bronchial epithelial cells.
19070599 2009 Inactivation of CREB mediated gene transcription by HDAC8 bound protein phosphatase.
19001277 2008 Loss of the Ca2+/calmodulin-dependent protein kinase type IV in dopaminoceptive neurons enhances behavioral effects of cocaine.
18988190 2009 Evidence that leptin through STAT and CREB signaling enhances cyclin D1 expression and promotes human endometrial cancer proliferation.
18930904 Homo sapiens lactate dehydrogenase c (Ldhc) gene expression in cancer cells is regulated by transcription factor Sp1, CREB, and CpG island methylation.
18922788 2008 BDNF selectively regulates GABAA receptor transcription by activation of the JAK/STAT pathway.
18801732 2008 AMP-activated protein kinase activation increases phosphorylation of glycogen synthase kinase 3beta and thereby reduces cAMP-responsive element transcriptional activity and phosphoenolpyruvate carboxykinase C gene expression in the liver.
18792986 2008 Genotype-phenotype correlations in Rubinstein-Taybi syndrome.
18775326 2008 RGS13 acts as a nuclear repressor of CREB.
18717645 2009 Stimulation by lithium of the interaction between the transcription factor CREB and its co-activator TORC.
18713830 2008 VRK1 phosphorylates CREB and mediates CCND1 expression.
18678793 2008 Association of a polymorphism near CREB1 with differential aversion processing in the insula of healthy participants.
18676828 2008 Cyclic AMP response element-binding protein overexpression: a feature associated with negative prognosis in never smokers with non-small cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18626018 2008 Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2.
18606955 2008 Systematic analysis of glutamatergic neurotransmission genes in alcohol dependence and adolescent risky drinking behavior.
18599546 2008 Temporal recruitment of transcription factors at the 3',5'-cyclic adenosine 5'-monophosphate-response element of the human GnRH-II promoter.
18554190 cAMP response element-binding protein is expressed at high levels in human ovarian adenocarcinoma and regulates ovarian tumor cell proliferation.
18511806 2008 CC chemokine receptor 5 gene promoter activation by the cyclic AMP response element binding transcription factor.
18485898 2008 CREB activates proteasomal degradation of DSCR1/RCAN1.
18483184 2008 Human gastrin-releasing peptide receptor gene regulation requires transcription factor binding at two distinct CRE sites.
18457359 2008 Inhibition of MITF and tyrosinase by paeonol-stimulated JNK/SAPK to reduction of phosphorylated CREB.
18396147 2008 CREB and Sp1 regulate the human CD2AP gene promoter activity in renal tubular epithelial cells.
18375384 2008 Human T-cell leukemia virus type 1 oncoprotein tax represses ZNF268 expression through the cAMP-responsive element-binding protein/activating transcription factor pathway.
18316612 2008 Molecular basis of nuclear factor-kappaB activation by astrocyte elevated gene-1.
18287226 2008 NF-kappaB-mediated activation of the chemokine CCL22 by the product of the human cytomegalovirus gene UL144 escapes regulation by viral IE86.
18189280 2008 Lithium response and genetic variation in the CREB family of genes.
18160048 2008 Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.
18070920 2008 The human T-cell leukemia virus type 1 tax protein confers CBP/p300 recruitment and transcriptional activation properties to phosphorylated CREB.
18034423 2007 Regulation of constitutive and microbial pathogen-induced human macrophage migration inhibitory factor (MIF) gene expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18024382 2007 cAMP response element binding protein (CREB) overexpression CREB has been described as critical for leukemia progression.
18022816 2008 Glutamate accelerates RPE cell proliferation through ERK1/2 activation via distinct receptor-specific mechanisms.
17975014 2008 CREB is a critical regulator of normal hematopoiesis and leukemogenesis.
17909078 2008 Calmodulin-dependent kinase IV links Toll-like receptor 4 signaling with survival pathway of activated dendritic cells.
17889508 2008 Gastrin transactivates the chromogranin A gene through MEK-1/ERK- and PKC-dependent phosphorylation of Sp1 and CREB.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17822787 Functional characterization of the promoter of human kinetochore protein HEC1: novel link between regulation of the cell cycle protein and CREB family transcription factors.
17805329 2008 CREB regulates Meis1 expression in normal and malignant hematopoietic cells.
17786359 2007 Expression of transcription factor CREB1 in human breast cancer and its correlation with prognosis.
17727817 2007 Inhibition of p38/CREB phosphorylation and COX-2 expression by olive oil polyphenols underlies their anti-proliferative effects.
17724745 2007 EWSR1-CREB1 is the predominant gene fusion in angiomatoid fibrous histiocytoma.
17712720 2007 Regulation of human MC2-R gene expression by CREB, CREM, and ICER in the adrenocortical cell line Y1.
17661722 2007 Potential role of CREB as a prognostic marker in acute myeloid leukemia.
17646388 2007 Regulation of mucin gene expression by CREB via a nonclassical retinoic acid signaling pathway.
17592483 2007 CREB1 haplotypes and the relative reinforcing value of nicotine.
17573727 2007 Variable p-CREB expression depicts different asthma phenotypes.
17565603 2007 CREB--a real culprit in oncogenesis.
17565599 2007 TORC-SIK cascade regulates CREB activity through the basic leucine zipper domain.
17565598 2007 CREB and cAMP response element-mediated gene expression in the ischemic brain.
17565597 2007 Transducer of regulated CREB and late phase long-term synaptic potentiation.
17548750 2007 Association between treatment-emergent suicidal ideation with citalopram and polymorphisms near cyclic adenosine monophosphate response element binding protein in the STAR*D study.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17507637 2007 A novel cyclic adenosine monophosphate responsive luciferase reporter incorporating a nonpalindromic cyclic adenosine monophosphate response element provides optimal performance for use in G protein coupled receptor drug discovery efforts.
17476304 2007 Cooperative interactions between CBP and TORC2 confer selectivity to CREB target gene expression.
17460549 2007 A splice site polymorphism in the G-protein beta subunit influences antidepressant efficacy in depression.
17455223 2007 Protein kinase Cdelta-mediated CREB activation regulates ghrelin-induced cyclooxygenase-2 expression and prostaglandin E2 production in human colonic epithelial cells.
17449469 2007 Molecular characterization of the Tax-containing HTLV-1 enhancer complex reveals a prominent role for CREB phosphorylation in Tax transactivation.
17426037 2007 Activation of the kinase activity of ATM by retinoic acid is required for CREB-dependent differentiation of neuroblastoma cells.
17389598 2007 Protein kinase D induces transcription through direct phosphorylation of the cAMP-response element-binding protein.
17310988 2007 cAMP-responsive element-binding protein regulates vascular endothelial growth factor expression: implication in human prostate cancer bone metastasis.
17300755 2007 Clinical and genetic dissection of anger expression and CREB1 polymorphisms in major depressive disorder.
17289023 2007 Regulation of the human SOX9 promoter by Sp1 and CREB.
17276404 2007 Differential activation of CREB by Akt1 and Akt2.
17202341 2007 IL-10 regulation by HIV-Tat in primary human monocytic cells: involvement of calmodulin/calmodulin-dependent protein kinase-activated p38 MAPK and Sp-1 and CREB-1 transcription factors.
17169345 2007 Phosphorylation-dependent degradation of transgenic CREB protein initiated by heterodimerization.
17082618 2006 Activating transcription factor/cAMP response element binding protein family member regulated transcription of CD1A.
16978443 2007 Cyclic AMP response element-binding protein in post-mortem brain of teenage suicide victims: specific decrease in the prefrontal cortex but not the hippocampus.
16963449 2007 Leptin transcriptionally enhances peptide transporter (hPepT1) expression and activity via the cAMP-response element-binding protein and Cdx2 transcription factors.
16920714 2006 Intracellular HIV-Tat expression induces IL-10 synthesis by the CREB-1 transcription factor through Ser133 phosphorylation and its regulation by the ERK1/2 MAPK in human monocytic cells.
16908542 2006 PGC-1-related coactivator: immediate early expression and characterization of a CREB/NRF-1 binding domain associated with cytochrome c promoter occupancy and respiratory growth.
16896160 2006 Mechanism for fetal hemoglobin induction by histone deacetylase inhibitors involves gamma-globin activation by CREB1 and ATF-2.
16822311 2006 Involvement of HTLV-I Tax and CREB in aneuploidy: a bioinformatics approach.
16820098 2006 Akt-and CREB-mediated prostate cancer cell proliferation inhibition by Nexrutine, a Phellodendron amurense extract.
16799563 2006 An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis.
16598418 2006 Phosphorylation of cAMP response element binding protein (CREB) as a marker of hypoxia in pituitary adenoma.
16483570 2006 Antiapoptotic effect of human T-cell leukemia virus type 1 tax protein correlates with its creb transcriptional activity.
16449647 2006 Transcriptional regulation of PEN-2, a key component of the gamma-secretase complex, by CREB.
16325578 2005 A nuclear function of beta-arrestin1 in GPCR signaling: regulation of histone acetylation and gene transcription.
16306050 2006 Platelet-activating factor mediates MMP-2 expression and activation via phosphorylation of cAMP-response element-binding protein and contributes to melanoma metastasis.
16293623 2006 DNA replication stress-induced phosphorylation of cyclic AMP response element-binding protein mediated by ATM.
16282323 2006 Evidence that Ser87 of BimEL is phosphorylated by Akt and regulates BimEL apoptotic function.
16227528 2005 Vasoactive intestinal peptide upregulates MUC2 intestinal mucin via CREB/ATF1.
16207795 2006 Hypoxia induces epithelial amphiregulin gene expression in a CREB-dependent manner.
16207717 2005 Mitochondrial cyclic AMP response element-binding protein (CREB) mediates mitochondrial gene expression and neuronal survival.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16158061 2005 IGF-II induces CREB phosphorylation and cell survival in human lung cancer cells.
16134057 2005 Expression of TNFalpha and its receptors R1 and R2 in human alveolar epithelial cells exposed to organic dust and the effects of 8-bromo-cAMP and protein kinase A modulation.
15999345 2005 Association study of CREB1 and childhood-onset mood disorders.
15964553 2005 TSSK5, a novel member of the testis-specific serine/threonine kinase family, phosphorylates CREB at Ser-133, and stimulates the CRE/CREB responsive pathway.
15917247 2005 Pellino3 is a novel upstream regulator of p38 MAPK and activates CREB in a p38-dependent manner.
15901830 2005 Induction of human NF-IL6beta by epidermal growth factor is mediated through the p38 signaling pathway and cAMP response element-binding protein activation in A431 cells.
15879136 2005 Cyclic AMP response element-binding protein positively regulates production of IFN-gamma by T cells in response to a microbial pathogen.
15837624 2005 The role of CREB as a proto-oncogene in hematopoiesis and in acute myeloid leukemia.
15753290 2005 Genome-wide analysis of cAMP-response element binding protein occupancy, phosphorylation, and target gene activation in human tissues.
15733869 2005 Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB.
15694837 2005 Dual-specificity tyrosine-phosphorylated and regulated kinase 1A (DYRK1A) interacts with the phytanoyl-CoA alpha-hydroxylase associated protein 1 (PAHX-AP1), a brain specific protein.
15691874 2005 Identification of human myometrial target genes of the cAMP pathway: the role of cAMP-response element binding (CREB) and modulator (CREMalpha and CREMtau2alpha) proteins.
15615708 2005 Prostaglandin E2 induces MUC8 gene expression via a mechanism involving ERK MAPK/RSK1/cAMP response element binding protein activation in human airway epithelial cells.
15588513 2004 Enhancement of cell survival by stromal cell-derived factor-1/CXCL12 involves activation of CREB and induction of Mcl-1 and c-Fos in factor-dependent human cell line MO7e.
15579595 2004 Cloning and expression of a novel CREB mRNA splice variant in human testis.
15500908 2004 The gene transcription factor cyclic AMP-responsive element binding protein: role in positive and negative affective states of alcohol addiction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454081 2004 The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector.
15340044 2004 Impaired CREB-1 phosphorylation in antifolate-resistant cell lines with down-regulation of the reduced folate carrier gene.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15153340 CREB regulates AChE-R-induced proliferation of human glioblastoma cells.
15082775 2004 CREB binds to multiple loci on human chromosome 22.
15077295 2004 Cyclooxygenase 2-derived prostaglandin E2 production by corticotropin-releasing hormone contributes to the activated cAMP response element binding protein content in rheumatoid arthritis synovial tissue.
14962944 2004 Involvement of neuron-derived orphan receptor-1 (NOR-1) in LDL-induced mitogenic stimulus in vascular smooth muscle cells: role of CREB.
14764597 2004 Peroxisome proliferator-activated receptor gamma activation modulates cyclin D1 transcription via beta-catenin-independent and cAMP-response element-binding protein-dependent pathways in mouse hepatocytes.
14761884 2004 Tumor necrosis factor activates CRE-binding protein through a p38 MAPK/MSK1 signaling pathway in endothelial cells.
14754893 2004 PE-1/METS, an antiproliferative Ets repressor factor, is induced by CREB-1/CREM-1 during macrophage differentiation.
14742439 2004 Identification of a novel cyclic AMP-response element (CRE-II) and the role of CREB-1 in the cAMP-induced expression of the survival motor neuron (SMN) gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646589 2003 Chronic activation of CREB and p90RSK in human epileptic hippocampus.
14597636 2004 Bruton's tyrosine kinase phosphorylates cAMP-responsive element-binding protein at serine 133 during neuronal differentiation in immortalized hippocampal progenitor cells.
14597631 2004 The coactivator of transcription CREB-binding protein interacts preferentially with the glycosylated form of Stat5.
14580193 2003 KIX-mediated assembly of the CBP-CREB-HTLV-1 tax coactivator-activator complex.
14536081 2003 TORCs: transducers of regulated CREB activity.
14523007 2003 Oxidized phospholipids induce expression of human heme oxygenase-1 involving activation of cAMP-responsive element-binding protein.
14506290 2003 Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells.
12871976 2003 Induction of Grp78/BiP by translational block: activation of the Grp78 promoter by ATF4 through and upstream ATF/CRE site independent of the endoplasmic reticulum stress elements.
12851637 2003 Sequence variations in CREB1 cosegregate with depressive disorders in women.
12829027 2003 Stem cell factor enhances erythropoietin-mediated transactivation of signal transducer and activator of transcription 5 (STAT5) via the PKA/CREB pathway.
12805224 2003 The thyroid hormone receptor antagonizes CREB-mediated transcription.
12773552 2003 Synergism between calcium and cyclic GMP in cyclic AMP response element-dependent transcriptional regulation requires cooperation between CREB and C/EBP-beta.
12743114 2003 Tissue transglutaminase directly regulates adenylyl cyclase resulting in enhanced cAMP-response element-binding protein (CREB) activation.
12720543 2003 Expression of cAMP response element-binding protein and sodium iodide symporter in benign non-functioning and malignant thyroid tumours.
12690113 2003 Interleukin-1 beta and tumor necrosis factor-alpha induce MUC5AC overexpression through a mechanism involving ERK/p38 mitogen-activated protein kinases-MSK1-CREB activation in human airway epithelial cells.
12676584 2003 MOZ-TIF2-induced acute myeloid leukemia requires the MOZ nucleosome binding motif and TIF2-mediated recruitment of CBP.
12622660 2003 Abnormal expression and functional characteristics of cyclic adenosine monophosphate response element binding protein in postmortem brain of suicide subjects.
12567184 2003 Attenuation of a phosphorylation-dependent activator by an HDAC-PP1 complex.
12552083 2003 Small ubiquitin-related modifier-1 modification mediates resolution of CREB-dependent responses to hypoxia.
12519783 2003 Alterations in the expression of transcription factors and the reduced folate carrier as a novel mechanism of antifolate resistance in human leukemia cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437352 2002 Structurally distinct modes of recognition of the KIX domain of CBP by Jun and CREB.
12391222 2002 Transcriptional regulation of the MHC class II trans-activator (CIITA) promoter III: identification of a novel regulatory region in the 5'-untranslated region and an important role for cAMP-responsive element binding protein 1 and activating transcription factor-1 in CIITA-promoter III transcriptional activation in B lymphocytes.
12391146 2002 Oct-1 potentiates CREB-driven cyclin D1 promoter activation via a phospho-CREB- and CREB binding protein-independent mechanism.
12368293 2002 Nitric oxide protects neuroblastoma cells from apoptosis induced by serum deprivation through cAMP-response element-binding protein (CREB) activation.
12235136 2002 Bi-functional, substrate mimicking RNA inhibits MSK1-mediated cAMP-response element-binding protein phosphorylation and reveals magnesium ion-dependent conformational changes of the kinase.
12220644 2002 Human gastrin-releasing peptide receptor mediates sustained CREB phosphorylation and transactivation in HuTu 80 duodenal cancer cells.
12200150 2002 CREB DNA binding activation by a 50-Hz magnetic field in HL60 cells is dependent on extra- and intracellular Ca(2+) but not PKA, PKC, ERK, or p38 MAPK.
12198160 2002 Ca2+-dependent block of CREB-CBP transcription by repressor DREAM.
12183445 2002 HLA-G transactivation by cAMP-response element-binding protein (CREB). An alternative transactivation pathway to the conserved major histocompatibility complex (MHC) class I regulatory routes.
12162494 2002 Induction of transcriptional activity of the cyclic adenosine monophosphate response element binding protein by parathyroid hormone and epidermal growth factor in osteoblastic cells.
12145339 2002 A cAMP-responsive element binding site is essential for sterol regulation of the human lanosterol 14alpha-demethylase gene (CYP51).
12091337 2002 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
11988318 2002 The expanding family of CREB/CREM transcription factors that are involved with spermatogenesis.
11909979 2002 MSK1 and MSK2 are required for the mitogen- and stress-induced phosphorylation of CREB and ATF1 in fibroblasts.
11698596 2001 Stimulation of endothelin B receptors in astrocytes induces cAMP response element-binding protein phosphorylation and c-fos expression via multiple mitogen-activated protein kinase signaling pathways.
11377386 2001 Role of p38 mitogen-activated protein kinase (p38 MAPK) in cytokine-induced rat islet cell apoptosis.
11313407 2001 Protein kinase C-theta participates in the activation of cyclic AMP-responsive element-binding protein and its subsequent binding to the -180 site of the IL-2 promoter in normal human T lymphocytes.
11175347 2000 NO activation of fos promoter elements requires nuclear translocation of G-kinase I and CREB phosphorylation but is independent of MAP kinase activation.
11160957 2001 Cognitive impairment in Coffin-Lowry syndrome correlates with reduced RSK2 activation.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11046156 2000 A family of LIM-only transcriptional coactivators: tissue-specific expression and selective activation of CREB and CREM.
11018520 2000 MSK1 is required for CREB phosphorylation in response to mitogens in mouse embryonic stem cells.
11013247 2001 Calmodulin kinase II attenuation of gene transcription by preventing cAMP response element-binding protein (CREB) dimerization and binding of the CREB-binding protein.
10909971 2000 Activating transcription factor-2 is a positive regulator in CaM kinase IV-induced human insulin gene expression.
10886376 2000 Direct imaging of phosphorylation-dependent conformational change and DNA binding of CREB by electron microscopy.
10781615 2000 The homeodomain protein Barx2 contains activator and repressor domains and interacts with members of the CREB family.
10722738 2000 cAMP-independent activation of the adenovirus type 12 E2 promoter correlates with the recruitment of CREB-1/ATF-1, E1A(12S), and CBP to the E2-CRE.
10720489 2000 Tip60 inhibits activation of CREB protein by protein kinase A.
10650954 2000 The 3',5'-cyclic adenosine monophosphate response element binding protein (CREB) is functionally reduced in human toxic thyroid adenomas.
10567391 1999 The role of human MBF1 as a transcriptional coactivator.
10074179 1999 Interaction of Gli2 with CREB protein on DNA elements in the long terminal repeat of human T-cell leukemia virus type 1 is responsible for transcriptional activation by tax protein.
9829964 1998 CREB is a regulatory target for the protein kinase Akt/PKB.
9792677 1998 RSK-B, a novel ribosomal S6 kinase family member, is a CREB kinase under dominant control of p38alpha mitogen-activated protein kinase (p38alphaMAPK).
9770464 1998 Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene.
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9558095 1998 Extracellular HIV-1 Tat protein induces the rapid Ser133 phosphorylation and activation of CREB transcription factor in both Jurkat lymphoblastoid T cells and primary peripheral blood mononuclear cells.
9413984 1997 Solution structure of the KIX domain of CBP bound to the transactivation domain of CREB: a model for activator:coactivator interactions.
9388250 1997 The CREB-binding protein (CBP) cooperates with the serum response factor for transactivation of the c-fos serum response element.
9065434 1997 Constitutive binding of the transcription factor interleukin-2 (IL-2) enhancer binding factor to the IL-2 promoter.
8887554 1996 FGF and stress regulate CREB and ATF-1 via a pathway involving p38 MAP kinase and MAPKAP kinase-2.
8798441 1996 CREB proteins function as positive regulators of the translocated bcl-2 allele in t(14;18) lymphomas.
8688081 1996 Coupling of the RAS-MAPK pathway to gene activation by RSK2, a growth factor-regulated CREB kinase.
8628277 1996 Fos-Jun dimerization promotes interaction of the basic region with TFIIE-34 and TFIIF.
8552098 1996 Phosphorylation of CREB at Ser-133 induces complex formation with CREB-binding protein via a direct mechanism.
8449898 1993 Glucocorticoid receptor-cAMP response element-binding protein interaction and the response of the phosphoenolpyruvate carboxykinase gene to glucocorticoids.
8384217 1993 Activating transcription factor-1 can mediate Ca(2+)- and cAMP-inducible transcriptional activation.
8381074 1993 The promoter of the gene encoding 3',5'-cyclic adenosine monophosphate (cAMP) response element binding protein contains cAMP response elements: evidence for positive autoregulation of gene transcription.
8065343 1994 Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression.
7809053 1994 An isoform of transcription factor CREM expressed during spermatogenesis lacks the phosphorylation domain and represses cAMP-induced transcription.
7621901 1995 Beta-adrenoceptor agonists interfere with glucocorticoid receptor DNA binding in rat lung.
7619208 1995 A novel cyclic AMP response element-binding protein-1 (CREB-1) splice product may down-regulate CREB-1 activity.
7608156 1995 Transcriptional activation of egr-1 by granulocyte-macrophage colony-stimulating factor but not interleukin 3 requires phosphorylation of cAMP response element-binding protein (CREB) on serine 133.
7554179 1995 cAMP response element binding protein is expressed and phosphorylated in the human heart.
7551568 1995 Serine 133-phosphorylated CREB induces transcription via a cooperative mechanism that may confer specificity to neurotrophin signals.
7505393 1993 Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells.
2974179 1988 Cyclic AMP-responsive DNA-binding protein: structure based on a cloned placental cDNA.
2196176 1990 Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain.
2142528 1990 Two distinct forms of active transcription factor CREB (cAMP response element binding protein).
2142119 1990 Assignment of the human gene for CREB1 to chromosome 2q32.3-q34.
1966745 1990 Diversification of cyclic AMP-responsive enhancer binding proteins-generated by alternative exon splicing.
1831258 1991 Nucleotide and derived amino-acid sequences of the CRE-binding proteins from rat C6 glioma and HeLa cells.
1827531 1991 HBV X protein alters the DNA binding specificity of CREB and ATF-2 by protein-protein interactions.
1655749 1991 The cAMP-regulated enhancer-binding protein ATF-1 activates transcription in response to cAMP-dependent protein kinase A.
1461747 1992 Cyclic AMP response element binding protein CREB and modulator protein CREM are products of distinct genes.
1386673 1992 Human T-cell lymphotropic virus type I (HTLV-I) transcriptional activator, Tax, enhances CREB binding to HTLV-I 21-base-pair repeats by protein-protein interaction.