Property Summary

NCBI Gene PubMed Count 27
PubMed Score 72.25
PubTator Score 179.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 3.4e-04
spina bifida 1064 4.0e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Disease Target Count Z-score Confidence
Cardiac arrest 26 3.237 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.110 3.4e-04
spina bifida -1.473 4.0e-02

Gene RIF (11)

PMID Text
25015815 In this review, the influence of the CGRP family peptides in reproduction and pregnancy is explored and discussed.
22074408 This study demonstrates the detailed expression of CGRP and its receptor components within spinal trigeminal nucleus in the brainstem and in the spinal cord at C1-level
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20099900 The extracellular protein domains corresponding to residues 23-133 of calcitonin receptor-like receptor and residues 26-117 of receptor activity-modifying protein 1 (RAMP1) are shown to be sufficient for formation of a stable, folded monodisperse complex.
19913063 Data describe the role of residues 23-60 of the calcitonin receptor-like receptor in binding with interaction sites within the N-terminus of the calcitonin gene-related peptide receptor.
19053766 analysis of the effects of antagonists to the CGRP receptor
18636754 A peptide mimetic demonstrates that 12 residues of family B member CGRP receptor proximal C-terminus are required for this receptor's expression and localization at the cell membrane.
17853344 Increased mRNA expression CGRP-RCP in gravid myometrium supports the possibility of involvement of CGRP in the control of myometrial contractility.
16406141 inhibition of ACE seems to augment CGRP catabolism.
12482973 human CGRP-RCP is the genuine orthologue of C17. CGRP-RCP was found to functionally replace C17 in Deltarpc17 yeast cells; CGRP-RCP was identified in a purified human Pol III preparation.
11937264 Expression of CGRP-RCP was detected in CD34+ cells and also in some mature granulocyte samples, providing evidence that CGRP-RCP may be regulated independently of RAMP1 and CRLR in hematopoietic cells.

AA Sequence

MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFL      1 - 70
TALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNV     71 - 140
AMDEEDPA                                                                  141 - 148
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25015815 2014 Calcitonin gene related family peptides: importance in normal placental and fetal development.
22074408 2011 Calcitonin gene-related peptide (CGRP) and its receptor components in human and rat spinal trigeminal nucleus and spinal cord at C1-level.
21223598 2011 Genome-wide joint SNP and CNV analysis of aortic root diameter in African Americans: the HyperGEN study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20099900 2010 Refolding and characterization of a soluble ectodomain complex of the calcitonin gene-related peptide receptor.
19913063 2010 Mapping interaction sites within the N-terminus of the calcitonin gene-related peptide receptor; the role of residues 23-60 of the calcitonin receptor-like receptor.
19053766 2008 Identification of potent, selective, and metabolically stable peptide antagonists to the calcitonin gene-related peptide (CGRP) receptor.
18636754 2008 Functional and biophysical analysis of the C-terminus of the CGRP-receptor; a family B GPCR.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17853344 2007 Expression of calcitonin gene-related peptide-receptor component protein (CGRP-RCP) in human myometrium in differing physiological states and following misoprostol administration.
16406141 2006 Angiotensin converting enzyme has an inhibitory role in CGRP metabolism in human skin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15636430 2004 Preliminary data suggest that mutations in the CgRP pathway are not involved in human sporadic cryptorchidism.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12490608 2003 Investigation of CGRP receptors and peptide pharmacology in human coronary arteries. Characterization with a nonpeptide antagonist.
12482973 2003 An Rpb4/Rpb7-like complex in yeast RNA polymerase III contains the orthologue of mammalian CGRP-RCP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391170 2002 Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.
12128288 2002 Calcitonin gene-related peptide in pregnancy and its emerging receptor heterogeneity.
11937264 2002 Regulation and function of the CGRP receptor complex in human granulopoiesis.
11804624 2002 Characterization of calcitonin gene-related peptide (CGRP) receptors and their receptor-activity-modifying proteins (RAMPs) in human brain microvascular and astroglial cells in culture.
11754963 2001 The role of the CGRP-receptor component protein (RCP) in adrenomedullin receptor signal transduction.
10903324 2000 CGRP-RCP, a novel protein required for signal transduction at calcitonin gene-related peptide and adrenomedullin receptors.
10067875 1999 Testes exhibit elevated expression of calcitonin gene-related peptide receptor component protein.
8622957 1996 Identification of a protein that confers calcitonin gene-related peptide responsiveness to oocytes by using a cystic fibrosis transmembrane conductance regulator assay.