1. Home
  2. Targets
  3. cell adhesion molecule
  4. membrane-bound signaling molecule
  5. Protein crumbs homolog 3

Tbio Protein crumbs homolog 3

Involved in the establishment of cell polarity in mammalian epithelial cells. Regulates the morphogenesis of tight junctions.

This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

 Comments

Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.27
PubTator Score 13.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 1.7e-02
Disease Target Count Z-score Confidence
Leber congenital amaurosis 72 3.973 2.0
Retinitis pigmentosa 156 3.454 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.7e-02

Synonym

Accession Q9BUF7 A8KA91 D6W643 Q8N0V8 Q8WVA0
Symbols

Gene

CRB3

PANTHER Protein Class (2)

PDB

5I7Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (12)

See all...

 GO Function (2)

 GO Component (7)

 GO Process (2)

 Compartment GO Term (29)

See all...

 MGI Phenotype (7)

 HCA RNA Cell Line (50)

See all...

Pathway (6)

Protein-protein Interaction (1)

PATJ  

Gene RIF (9)

PMID Text
26975581 Data show different intracellular mobility patterns for crumbs 3 proteins Crb3A and Crb3B.
26217016 CRB3A recruits p114RhoGEF and its activator Ehm2 to the cell periphery using both functional motifs of its cytoplasmic tail and increases RhoA activation levels.
25406012 our data demonstrated that CRB3 may be used as a new independent favorable prognostic factor for human ccRCC
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
17988153 overexpression of human CRB1 and related isoforms, CRB2 and CRB3, had no effect on the levels of presenilin complex components, on NCT maturation or on PS endoproteolysis
17646395 Data show that a novel Crumbs3 isoform regulates cell division and ciliogenesis via importin beta1 interactions.
15976445 The crumbs3 protein plays an important role in epithelial tight junction formation, and also provide the first known functional role for the mammalian Crumbs FERM binding domain.
14718572 CRB3, through its cytoplasmic domain and its interactors, plays a role in apical membrane morphogenesis and tight junction regulation.
12771187 the Crumbs3-Pals1 complex has a role in development of polarity in mammalian epithelial cells

AA Sequence 

MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAAL      1 - 70
LLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI                         71 - 120
//

Text Mined References (20)

PMID Year Title
26975581 2016 The C-terminal domain controls the mobility of Crumbs 3 isoforms.
26217016 2015 CRB3A Controls the Morphology and Cohesion of Cancer Cells through Ehm2/p114RhoGEF-Dependent Signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25406012 2015 Cell polarity protein CRB3 is an independent favorable prognostic factor for clear cell renal cell carcinoma.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17988153 2007 Overexpression of human CRB1 or related isoforms, CRB2 and CRB3, does not regulate the human presenilin complex in culture cells.
17646395 2007 A novel Crumbs3 isoform regulates cell division and ciliogenesis via importin beta interactions.
17332497 2007 The MAGUK protein MPP7 binds to the polarity protein hDlg1 and facilitates epithelial tight junction formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15976445 2005 Multiple regions of Crumbs3 are required for tight junction formation in MCF10A cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14718572 2004 CRB3 binds directly to Par6 and regulates the morphogenesis of the tight junctions in mammalian epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12771187 2003 The Crumbs3-Pals1 complex participates in the establishment of polarity in mammalian epithelial cells.
12527193 2003 Mammalian Crumbs3 is a small transmembrane protein linked to protein associated with Lin-7 (Pals1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964389 2002 hINADl/PATJ, a homolog of discs lost, interacts with crumbs and localizes to tight junctions in human epithelial cells.