Property Summary

NCBI Gene PubMed Count 40
PubMed Score 21.93
PubTator Score 20.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.700 2.5e-07
psoriasis 1.300 1.5e-04
tuberculosis and treatment for 3 months -1.700 9.9e-06
pancreatic ductal adenocarcinoma liver m... -1.498 1.2e-03
inflammatory breast cancer -1.200 2.8e-03

Protein-protein Interaction (2)

Gene RIF (11)

PMID Text
24958727 define a novel function for CRADD in endothelial cells as an inducible suppressor of BCL10, a key mediator of responses to proinflammatory agonists
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20406701 point mutations on RAIDD (R147E) and on PIDD (Y814A) exert a dominant negative effect on the formation of the PIDDosome, and that this effect cannot be applied after the PIDDosome has been formed
20237496 Observational study of gene-disease association. (HuGE Navigator)
20208132 The expressions of PIDD and RAIDD are upregulated during tumour progression in renal cell carcinomas.
19582216 Crystals are trigonal and belong to space group P3(1)21 (or its enantiomorph P3(2)21) with unit-cell parameters a = 56.3, b = 56.3, c = 64.9 A and gamma = 120 degrees .
19125251 impaired expression of RAIDD in drug induced apoptosis may play a role in the multidrug resistance of osteosarcoma cells
17329820 PIDD death domain (DD) and RAIDD DD assemble into an oligomeric complex. Within the PIDDosome, the interaction between PIDD and RAIDD is mediated by a homotypic interaction between their death domains.
16434054 As a first step towards elucidating the molecular mechanisms of caspase-2 activation, data report the crystal structure of the RAIDD death domain at 2.0 A resolution.

AA Sequence

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD      1 - 70
TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL     71 - 140
SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE               141 - 199
//

Text Mined References (42)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25936804 2015 An Inhibitor of PIDDosome Formation.
25416956 2014 A proteome-scale map of the human interactome network.
24958727 2014 The adaptor CRADD/RAIDD controls activation of endothelial cells by proinflammatory stimuli.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
21726810 2011 Caspase-2-mediated cleavage of Mdm2 creates a p53-induced positive feedback loop.
21242994 2011 LBH589, a deacetylase inhibitor, induces apoptosis in adult T-cell leukemia/lymphoma cells via activation of a novel RAIDD-caspase-2 pathway.
20935634 2010 The Fas-FADD death domain complex structure reveals the basis of DISC assembly and disease mutations.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20872280 2010 In vitro reconstitution of the interactions in the PIDDosome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20406701 2010 Identification and analysis of dominant negative mutants of RAIDD and PIDD.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20208132 2010 PIDDosome expression and the role of caspase-2 activation for chemotherapy-induced apoptosis in RCCs.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19582216 2009 Purification, crystallization and preliminary x-ray crystallographic studies of RAIDD Death-Domain (DD).
19125251 2009 RAIDD expression is impaired in multidrug resistant osteosarcoma cell lines.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17329820 2007 Crystallization and preliminary X-ray crystallographic studies of the oligomeric death-domain complex between PIDD and RAIDD.
17159900 2007 Autoproteolysis of PIDD marks the bifurcation between pro-death caspase-2 and pro-survival NF-kappaB pathway.
16652156 2006 Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage.
16541075 2006 The finished DNA sequence of human chromosome 12.
16434054 2006 Crystal structure of RAIDD death domain implicates potential mechanism of PIDDosome assembly.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15073321 2004 The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress.
14765136 2004 RAIDD aggregation facilitates apoptotic death of PC12 cells and sympathetic neurons.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11832478 2002 Caspase-2 induces apoptosis by releasing proapoptotic proteins from mitochondria.
11771742 2001 Expression of apoptosis related proteins: RAIDD, ZIP kinase, Bim/BOD, p21, Bax, Bcl-2 and NF-kappaB in brains of patients with Down syndrome.
11156409 2000 Identification of a caspase-2 isoform that behaves as an endogenous inhibitor of the caspase cascade.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
10903735 2000 Fas ligand-induced c-Jun kinase activation in lymphoid cells requires extensive receptor aggregation but is independent of DAXX, and Fas-mediated cell death does not involve DAXX, RIP, or RAIDD.
10713730 2000 Subcellular localization and CARD-dependent oligomerization of the death adaptor RAIDD.
9695946 1998 Solution structure of the RAIDD CARD and model for CARD/CARD interaction in caspase-2 and caspase-9 recruitment.
9044836 1997 CRADD, a novel human apoptotic adaptor molecule for caspase-2, and FasL/tumor necrosis factor receptor-interacting protein RIP.
8985253 1997 RAIDD is a new 'death' adaptor molecule.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8617505 1996 The I.M.A.G.E. Consortium: an integrated molecular analysis of genomes and their expression.